KEGG   Edwardsiella anguillarum: ETEE_2360Help
Entry
ETEE_2360         CDS       T03245                                 

Gene name
folA
Definition
(GenBank) Dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
ete  Edwardsiella anguillarum
Pathway
ete00670  One carbon pool by folate
ete00790  Folate biosynthesis
ete01100  Metabolic pathways
Module
ete_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ete00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ETEE_2360 (folA)
   00670 One carbon pool by folate
    ETEE_2360 (folA)
Enzymes [BR:ete01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     ETEE_2360 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AIJ08802
UniProt: A0A076LQ28
Position
2389105..2389587
Genome map
AA seq 160 aa AA seqDB search
MIISLIAALSADRVIGLDNAMPWHLPADLAWFKRNTLAKPVIMGRKTYESIGRPLPGRHN
IVISRQAGSDDRVTWVTTPQAALDAAAEAQEVMIIGGGSIYSQFLPQASRLYLTHVDADV
AGDTYFPDYASDEWQTCFSEFHDADSDNSHAYCFEILDRR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgattatcagcctgatcgccgcactgagcgcggatcgtgtgatcggtttagacaatgcg
atgccgtggcatttgccggccgatcttgcgtggtttaagcgtaatactctggcaaaaccg
gtgatcatggggcgtaagacctatgagtccatcgggcgtccgctgccggggcggcataac
atcgtgatcagccgccaggcgggcagcgacgatcgcgtaacctgggtgacgacgccgcag
gcggcgctggacgcagctgcggaggcgcaagaggtgatgatcatcggcggaggcagcatt
tacagccagtttttgccgcaggcgagccggctgtatctgacccatgtggacgctgacgtc
gcaggggacacctattttcccgactatgcgtcggatgagtggcagacgtgcttcagcgag
tttcatgacgccgatagcgacaattcacacgcctattgctttgagatcctggatcgccgt
taa

DBGET integrated database retrieval system