KEGG   Edwardsiella anguillarum: ETEE_2362Help
Entry
ETEE_2362         CDS       T03245                                 

Gene name
apaG
Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
ete  Edwardsiella anguillarum
Brite
KEGG Orthology (KO) [BR:ete00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    ETEE_2362 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AIJ08804
UniProt: A0A076LT70
Position
complement(2390663..2391040)
Genome map
AA seq 125 aa AA seqDB search
MIDAPRIIVQVQSVYAGSQSLPEEARFVFAYTVTLRNLGRFNVQLLRRYWLITNGNGRQT
EVQGEGVIGEQPLILPNGEFQYTSGAIIETPCGTMEGHYEMVDHQGHTFRIAIPVFRLAI
PSLIN
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatgcaccccgtatcatcgttcaggtacagagtgtctatgccggatcgcagtcg
ctgcctgaagaggcgcgcttcgtctttgcctataccgtcactctgcgtaatctgggccgc
tttaacgtacagctcctgcgccgctactggctaataaccaacggcaacggccgccagact
gaagtccagggcgaaggggtcatcggcgaacagccgctgatcctgcccaacggcgagttt
cagtacaccagcggcgccatcatcgaaacgccctgcggtaccatggaggggcactacgaa
atggttgaccatcaaggacacaccttccgtatcgccattccggtcttccgcctggccatt
cccagcctgattaactga

DBGET integrated database retrieval system