KEGG   Edwardsiella anguillarum: ETEE_4006Help
Entry
ETEE_4006         CDS       T03245                                 

Gene name
ipdC
Definition
(GenBank) Pyruvate decarboxylase; Alpha-keto-acid decarboxylase
  KO
K04103  indolepyruvate decarboxylase [EC:4.1.1.74]
Organism
ete  Edwardsiella anguillarum
Pathway
ete00380  Tryptophan metabolism
ete01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ete00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    ETEE_4006 (ipdC)
Enzymes [BR:ete01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.74  indolepyruvate decarboxylase
     ETEE_4006 (ipdC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AIJ10414
UniProt: A0A076LYC0
Position
complement(4010766..4012412)
Genome map
AA seq 548 aa AA seqDB search
MSTTVIEYVLSRLYELGIHDIFGVPGDYAFPIEDAICADKRLRWIGNCNELNAAYAADAY
ARTRGLAALSTTFGVGELSAINGIAGACAESVTLFHLVGMPASHVQARGECVHHTLGNGY
FTPFYEATASFVCARAIMTPENCIAETERLIAAALRYRKPVYMAFPSDYATMPVVESRVP
AAPAPVSDPRVLNEVIDVIAARLNNSDSVCVLPGIYLARHGAQRAATALIDAANLPFATM
MMDKCVIDESHPNYVGMYVGQLMDQRVRQFVESSDCVLKIGTIMSDFNTGAFTSRLDEAQ
CISVEPASVRIGQSVYENVLMKDVLSGLMGRVTRRARRHDMPAAQGIPAVSGSGRLTAEY
LYARWQQMLKPNDRLVAETGTTSMGLAFARMPQGAVFYQQTLWGSIGWATPAAFGVAMAE
PEKRTILITGEGSHQMTAQEIGQFYRFGLKPLIFVVNNGGYLVERMLCKDGDIYYNDLAQ
WDYSQLPAGLGCRDWFTARVTTCEALDEAIRHAEAGDCGAYIEVVTDKYVTSELLEKMHG
ALTSLYSA
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgtctacaacggttatcgaatatgtactgtcacggctatatgagttggggattcatgac
attttcggcgttccgggggattatgccttcccgattgaggacgccatctgtgcggacaaa
cgtctgcgctggataggcaactgcaatgagctgaacgccgcctatgcggccgatgcctac
gcccgcacccgtggcctggccgcgctgagtaccacctttggcgtgggtgagctaagcgcg
ataaacggcatcgccggcgcctgcgccgagtcggtcacgctgttccatctggtcggcatg
ccggcaagtcatgtccaggcgcggggagagtgcgtgcaccatacgctgggcaacggctat
tttacgccgttctatgaggccacggcctccttcgtctgcgcccgcgccattatgacgccg
gaaaactgcatcgcagagaccgagcgcctgatcgcggcggcgctgcgctaccgtaagccg
gtgtatatggctttccccagcgattacgccacgatgccggtcgtggagagccgcgtaccg
gcggcgcccgcacccgtcagcgatccacgggtcctgaatgaggtgatcgatgttatcgcc
gcgcgcctgaataacagcgatagtgtctgcgtgctgccggggatttatctggcccgccac
ggcgcacagagggcggcgacggcgttgatcgacgccgctaacctgccgtttgccaccatg
atgatggataagtgcgtgatcgatgagtcccatccgaactacgttggaatgtatgtcggc
caactgatggaccaacgggtgcgccagtttgtggagagcagcgattgcgtactgaaaatc
ggcaccatcatgagcgactttaacaccggggcgtttacctcgcgcctggacgaggcgcag
tgcatcagcgtggagccggcctcggttcgtatcggtcagtcggtctatgagaacgtgctg
atgaaggatgtgctgagcggactgatggggcgggtgacccgccgggcccgccgccacgat
atgccggcggctcaggggatccccgcggtgagcggcagcggcaggctgaccgcggagtac
ctctacgcacgctggcagcagatgctgaagccgaacgatcggctggtggcggagaccggc
accacctccatggggctggccttcgcccggatgccgcagggcgccgtgttttatcagcag
accctgtggggctctatcggctgggcgacgccggcggcattcggcgtcgcgatggcggag
ccagagaaacgcaccatcctgatcaccggcgaaggctcgcaccagatgacggcgcaggag
atcggccagttctatcgctttggcctgaagccgctgatctttgtggtgaacaacggcggt
tatctggtcgagcgtatgctgtgcaaggacggcgacatctactacaacgatctggcgcag
tgggactacagccaactgccggcggggctgggctgccgcgattggtttaccgcccgggtg
accacctgcgaggcgctggatgaggcgatccgccatgccgaagccggtgactgcggcgcc
tacatcgaggtggtcaccgataagtatgtcacctccgagctgctggagaagatgcacggc
gcgctgacgtcgctctactccgcctga

DBGET integrated database retrieval system