KEGG   Edwardsiella anguillarum: ETEE_4074Help
Entry
ETEE_4074         CDS       T03245                                 

Gene name
atoB
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ete  Edwardsiella anguillarum
Pathway
ete00071  Fatty acid degradation
ete00072  Synthesis and degradation of ketone bodies
ete00280  Valine, leucine and isoleucine degradation
ete00310  Lysine degradation
ete00380  Tryptophan metabolism
ete00620  Pyruvate metabolism
ete00630  Glyoxylate and dicarboxylate metabolism
ete00640  Propanoate metabolism
ete00650  Butanoate metabolism
ete00900  Terpenoid backbone biosynthesis
ete01100  Metabolic pathways
ete01110  Biosynthesis of secondary metabolites
ete01120  Microbial metabolism in diverse environments
ete01130  Biosynthesis of antibiotics
ete01200  Carbon metabolism
ete01212  Fatty acid metabolism
ete02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ete00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ETEE_4074 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    ETEE_4074 (atoB)
   00640 Propanoate metabolism
    ETEE_4074 (atoB)
   00650 Butanoate metabolism
    ETEE_4074 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ETEE_4074 (atoB)
   00072 Synthesis and degradation of ketone bodies
    ETEE_4074 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ETEE_4074 (atoB)
   00310 Lysine degradation
    ETEE_4074 (atoB)
   00380 Tryptophan metabolism
    ETEE_4074 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ETEE_4074 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ETEE_4074 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETEE_4074 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ete04147]
    ETEE_4074 (atoB)
Enzymes [BR:ete01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ETEE_4074 (atoB)
Exosome [BR:ete04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ETEE_4074 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIJ10480
UniProt: A0A076LPD1
Position
4089869..4091053
Genome map
AA seq 394 aa AA seqDB search
MKNCVIVSAVRTAIGSFNGALSQMGAVDLGATVIRAALERARLDPQRVDEVIMGNVLQAG
LGQNPARQALLRAGLSEAVCGFTVNKVCGSGLKSVALAAQAIQAGQALALVAGGMENMSQ
APYLLSAKARWGYRLGDGTLTDVILQDGLLCATHGYPMGITAENIAREYGISREMQDALA
LHSQQKAARALQRGAFQAEIVPVSVTSRKKTTLVERDEFPKADSTAEGLSTLRPAFDKAG
SVTAGNASGINDGAAALVVMEESAARAAGLTPLARIKGYASAGVAPALMGMGPVPAAQKA
LRQCGLQIADIDLIEANEAFAAQFLAVGKTLGLDAEKVNVNGGAIALGHPIGASGARILV
TLLHALAARDKTLGLATLCIGGGQGIALIVERIG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattgtgtcatcgtcagcgcggtacgcaccgccatcggcagcttcaacggcgcc
ctgtctcagatgggtgccgtcgatctgggtgccacggtcatcagggccgccctggaacgc
gcccgcctcgacccgcagcgggtggatgaggtgatcatgggcaacgtgctgcaggccggc
ctggggcaaaacccggcgcgccaggcgctgctgcgggccggcctcagcgaggcggtctgc
ggttttaccgtcaacaaggtctgcggatcggggcttaagagcgtggcgctggccgcccag
gccattcaggcggggcaggcgctggcgctggtcgccggcggcatggaaaacatgagtcag
gcgccgtacctgctgagtgcaaaggcgcgctggggctaccgcctcggcgacggcacgctg
accgacgtcatcctgcaggatggtctgctgtgcgccacccacggctacccgatggggatc
accgccgaaaacatcgcccgcgaatacggcatcagccgtgagatgcaggacgcgctggcc
ctgcactcccagcaaaaggcggcccgcgccctccagcgcggcgcgtttcaggccgagatc
gtcccggtcagcgtgacatcgcgtaaaaaaaccaccctcgttgagcgcgacgaattcccc
aaagccgactccacggcggaagggctttccaccctgcgcccggcgttcgataaagccggc
agcgtcaccgccggcaacgcctcggggatcaacgacggcgcggcggcgctggtggtgatg
gaggaaagcgccgcccgggcggcggggctgacgccgctggcgcggattaagggctatgcc
agcgccggcgtcgcgccggcgctgatggggatggggccggtccccgccgcccagaaggcg
ctgcgccagtgtgggctgcagatagccgacatcgatctgatcgaggccaatgaagccttt
gccgcgcaattcctggccgtcggcaagacgctggggctggatgccgagaaggtgaacgtc
aacggcggcgccatcgcgctgggtcaccccatcggcgccagcggcgcccggatcctggtc
accctgctgcacgcgctcgccgcccgagacaaaaccctggggctggcgacgctgtgcatc
ggcggcggccaggggatcgccctgatcgtggagaggatcggctaa

DBGET integrated database retrieval system