KEGG   Enterococcus thailandicus: CK496_00355Help
Entry
CK496_00355       CDS       T05312                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
eth  Enterococcus thailandicus
Pathway
eth03010  Ribosome
Brite
KEGG Orthology (KO) [BR:eth00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CK496_00355
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:eth03011]
    CK496_00355
Ribosome [BR:eth03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CK496_00355
  Bacteria
    CK496_00355
  Archaea
    CK496_00355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ASZ06451
UniProt: A0A179ESF2
Position
69570..69917
Genome map
AA seq 115 aa AA seqDB search
MAEQITSAKATAKTVRTSPRKARLVIDLIRGKSVADAISILKFTPNKSAGIIEKVLMSAV
ANAENNFDLDVENLVVSEAFINEGPTMKRFRPRAKGSASPINKRTSHITVVVSEK
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacaaatcacatcagctaaagcaactgcaaaaacagttcgcacttcacctcga
aaagcccgtttagtaattgaccttatcagaggtaaaagtgttgcggatgcaatttcaatt
ttgaaattcacaccgaacaaatctgctggaatcatcgagaaagtcttgatgtcagcagtt
gcaaatgcagaaaataattttgacttagacgttgaaaatttagtagtatctgaagctttt
attaacgaaggaccaacaatgaaacgtttccgtccacgtgcaaaagggtcagcttctcca
atcaacaaacgtacaagtcatattacagtagtcgtatcagaaaaataa

DBGET integrated database retrieval system