KEGG   Enterococcus thailandicus: CK496_01915Help
Entry
CK496_01915       CDS       T05312                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
eth  Enterococcus thailandicus
Pathway
eth00480  Glutathione metabolism
eth00590  Arachidonic acid metabolism
eth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eth00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    CK496_01915
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CK496_01915
Enzymes [BR:eth01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CK496_01915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin DUF4174 DUF823
Motif
Other DBs
NCBI-ProteinID: ASZ06743
UniProt: A0A249SGK3
Position
complement(398289..398765)
Genome map
AA seq 158 aa AA seqDB search
MTVYDFDATLENGTTYSLNDYRNHPMIIVNTATKCGLAPQFEQLEQLYTTYKEKGLVVLG
FPSNQFKQELDSAEEAAQACRTTYGVSFPMHQLVELNGAATDPLFAYLKENAPGTMTNAI
KWNFTKFLIDKDGAVIKRFAPQTSPEKMIDDIEKLLAE
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgacagtttatgattttgatgcaactttggaaaatggaactacttactctctaaacgac
taccggaatcatccaatgattatcgttaatactgcaaccaaatgtggacttgctccacaa
tttgagcagcttgaacaactttacactacctataaagaaaaaggattagtcgttttaggc
tttccttccaaccaatttaaacaagaactggattctgctgaagaagcggcgcaagcttgt
cgaactacttatggtgtttcatttccaatgcatcaattagtcgaattaaatggagcagct
actgatcctttattcgcctatttgaaggaaaatgcacctggtacaatgactaacgcaatt
aaatggaatttcaccaaatttttaattgataaagatggagctgtcatcaaacgctttgca
ccacagacttctcctgaaaagatgattgatgatatcgaaaagcttcttgctgaatag

DBGET integrated database retrieval system