KEGG   Enterococcus thailandicus: CK496_07815Help
Entry
CK496_07815       CDS       T05312                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
eth  Enterococcus thailandicus
Pathway
eth00010  Glycolysis / Gluconeogenesis
eth00020  Citrate cycle (TCA cycle)
eth00620  Pyruvate metabolism
eth01100  Metabolic pathways
eth01110  Biosynthesis of secondary metabolites
eth01120  Microbial metabolism in diverse environments
eth01130  Biosynthesis of antibiotics
eth01200  Carbon metabolism
Module
eth_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:eth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CK496_07815
   00020 Citrate cycle (TCA cycle)
    CK496_07815
   00620 Pyruvate metabolism
    CK496_07815
Enzymes [BR:eth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CK496_07815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding HlyD_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: ASZ07819
UniProt: A0A249SJP9
Position
complement(1673060..1674685)
Genome map
AA seq 541 aa AA seqDB search
MAYQFKLPDIGEGIAEGEIVKWFVKAGDTINEDDTLLEVQNDKSVEEIPSPITGTVKNVL
VPEGTVANVGDVLVEIDAPGYEDSEPAAPAQEQTPESPAATPTAEGSSEGVFEFKLPDIG
EGIAEGEIVKWFVKAGDTINEDDTLLEVQNDKSVEEIPSPVTGTVKNVLVPEGTVANVGD
VLVEIDAPGHNTSQSSAPSTQAPAAAAPQETKAAPSTVVATADESKRILAMPSVRQYARE
KDVDISQVTATGKGGRITKEDIDQFASGGAPVQATAPEAAPTAAKATPEAPAAAPKAEPA
AFKSGQAERETREALTPTRKAIAKAMVNSKHTAPHVTLHDDVEVSKLWDHRRKFKDVAAE
NDTKLTFLPYVVKALTATAKKFPVLNASIDDKTQEIVYKHYYNIGIATDTDHGLYVPNIK
DANMKSMFAIADEINEKAALAHDGKLSAQDMRDGSITISNIGSVGGGWFTPVINYPEVAI
LGVGTIAQQPVVNSEGEIVVGRVMKLSLSFDHRIVDGATAQKAMNNIKRLLADPELLLME
G
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggcttatcaatttaaattaccggatatcggtgaagggattgcagaaggcgaaatcgta
aaatggttcgttaaagcaggcgacacgatcaatgaagacgatacattgttagaagttcaa
aacgacaaatcagttgaagaaattccatctcctattacaggaacggttaaaaacgtatta
gttccagaaggcactgtggcaaatgtgggtgatgttttagtagaaatcgatgcacctggt
tatgaagatagcgaaccagctgctcccgctcaagaacaaacacctgaatctcctgctgca
acaccaacagctgaaggttctagtgaaggcgtctttgaatttaaattaccggatatcggt
gaaggaattgcagaaggcgaaatcgtaaaatggtttgttaaagcaggcgacacaatcaac
gaagatgatacattattagaagtccaaaatgacaaatcagttgaagaaattccatcacct
gttactggaacagtcaaaaacgtattagttccagaaggtactgtggcaaatgtgggtgat
gttttggtagaaatcgatgcaccaggacataacacaagtcaatcttcagcaccaagtacc
caagcaccagctgcggcagctcctcaagaaacaaaagctgcgccatcaacagttgttgct
acagctgacgaatcaaaacgcattcttgcaatgccttctgttcgtcaatatgctcgcgaa
aaagatgtagatatctcacaagtaactgctactggaaaaggtggccgtatcacaaaagaa
gatatcgatcaatttgcttcaggtggcgcacctgttcaagcgactgcaccagaagcagca
ccaacagctgcaaaagcaacgccagaagcaccggctgctgcaccaaaagcagaaccagct
gcattcaagtctggtcaagcagagcgtgaaactcgtgaagctttaacaccaacacgtaaa
gcaattgctaaagcgatggttaatagcaaacacacagcaccacatgtaactttacatgat
gatgttgaggtttcaaaactttgggatcaccgtaggaaatttaaagatgttgctgctgaa
aatgacacaaaattaactttcttaccatatgttgttaaagcattgacagcaactgcgaag
aaattcccagtgttgaatgcgtcaattgatgacaaaacacaagaaattgtgtacaaacat
tactacaatattggtattgcaactgatacggaccacgggttgtatgtaccaaatatcaaa
gatgcaaacatgaagagtatgtttgcgattgctgatgaaatcaatgaaaaagcagcatta
gcgcacgatggtaaactttctgcccaagatatgcgtgatggctcaattacaatcagtaat
attggttctgttggtggtggttggtttacaccagttatcaactaccctgaagttgctatt
ttaggtgtgggtacaattgcacaacaaccagtcgtgaatagcgagggtgaaatcgttgtt
ggtcgcgtgatgaaattatcattaagctttgatcatcgaatcgttgacggtgcaactgca
cagaaagcaatgaataacatcaaacgtttattagcagatccagaattattattgatggaa
ggatga

DBGET integrated database retrieval system