KEGG   Enterococcus thailandicus: CK496_08765Help
Entry
CK496_08765       CDS       T05312                                 

Definition
(GenBank) polyprenyl synthetase family protein
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
eth  Enterococcus thailandicus
Pathway
eth00900  Terpenoid backbone biosynthesis
eth01100  Metabolic pathways
eth01110  Biosynthesis of secondary metabolites
eth01130  Biosynthesis of antibiotics
Module
eth_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:eth00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CK496_08765
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:eth01006]
    CK496_08765
Enzymes [BR:eth01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     CK496_08765
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     CK496_08765
    2.5.1.29  geranylgeranyl diphosphate synthase
     CK496_08765
Prenyltransferases [BR:eth01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   CK496_08765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt CENP-R
Motif
Other DBs
NCBI-ProteinID: ASZ07997
UniProt: A0A1L8XS97
Position
complement(1866442..1867332)
Genome map
AA seq 296 aa AA seqDB search
MQLTEFSATNLPMVEQEITQFLMEYTTDEALKESMLYSINAGGKRIRPLLLLATASSFGE
TLSTPIYQVAGALEMVHTYSLIHDDLPAMDNDDLRRGKPTNHKVFGEAIAILAGDGLLTG
AFQLISLTQLEPLKKLLLIQQLASNSGAQGMVAGQTADILGEKQELTIEELAFVHERKTG
RLIRYALLAGGVLANQPEEVLMCLQKLAGHLGLAFQIRDDLLDVVSTTEKLGKTAGKDAQ
EGKNTYPRLLGIEKTYAALANEIQQANELVTQLEKDVLVFDGELLRQLIRQFDMEK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcaattaaccgaattttcagcaaccaatttaccgatggttgaacaagaaattacccaa
tttttaatggaatatacaactgatgaagcattgaaagagagtatgctttattcgattaat
gctggtggaaaacgaattagaccattactacttttagcgacagcaagttcctttggtgaa
acattatctactcccatatatcaagtagcaggggctcttgaaatggttcatacgtactca
ttaatccatgatgatctacctgcaatggacaatgatgatttacgtagaggaaaaccgaca
aaccataaagtttttggtgaagcaattgctattttggctggagatggcctgttgacaggg
gcgtttcaattaattagtttgacacaactagaacccttaaaaaagttattgcttatccaa
caattggcaagtaatagtggggctcaaggaatggtagccgggcaaacggcagatatttta
ggtgaaaaacaagaattgactatagaagaacttgcctttgtccatgaacgaaaaacaggt
cgcttgattcgctatgcgttgttagcaggtggtgttttagctaatcagccagaagaagtt
ttgatgtgtttacaaaaattggctggacatctcggacttgcttttcaaattcgggatgat
ctattagatgtggtgagtacaaccgaaaaattaggtaagacagctggtaaagatgcgcaa
gaaggaaaaaatacgtatccgcgtttactaggaattgaaaaaacgtatgcagctttagca
aatgaaatccaacaagccaatgaattggttacacagttagaaaaagatgttttagtattt
gatggcgagttgctacgtcaattaatcagacaatttgatatggagaaatga

DBGET integrated database retrieval system