KEGG   Empidonax traillii (willow flycatcher): 114054952Help
Entry
114054952         CDS       T05887                                 

Gene name
CAMKK2
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase kinase 2 isoform X1
  KO
K07359  calcium/calmodulin-dependent protein kinase kinase 2 [EC:2.7.11.17]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04140  Autophagy - animal
etl04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114054952 (CAMKK2)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    114054952 (CAMKK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etl01001]
    114054952 (CAMKK2)
Enzymes [BR:etl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     114054952 (CAMKK2)
Protein kinases [BR:etl01001]
 Serine/threonine kinases: Other
  CAMKK family
   114054952 (CAMKK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal RIO1 APH
Motif
Other DBs
NCBI-GeneID: 114054952
NCBI-ProteinID: XP_027734373
Position
Unknown
AA seq 517 aa AA seqDB search
MASLIVVTEHDAAASASEEEMDVPGSDGFRDGRKLHLSGRKLSLQERPQPARSPGNGDGA
NERFIYPSLPYSPVTSPHSSPRLPRRPTVESNRVSITGLQDCVQLNQYKLKDEIGKGSYG
VVKLAYNEDDNTYYAMKVLSKKKLMRQAGFPRRPPPRGAKVASEGCLQPRGPIEQVYQEI
AILKKLDHPNVVKLVEVLDDPSEDHLYMVFELVKQGPVMEIPTLKPLSEDQARFYFQDLI
KGIEYLHYQKIIHRDIKPSNLLVGEDGHVKIADFGVSNEFKGADALLTNTVGTPAFMAPE
TLSETRKIFSGKALDVWAMGITLYCFVFGQCPFMDERILSLHNKIKTQTLEFPDQPEVTD
FLKDLITRMLDKNPESRISVPEIKESTVQQPFAGDFWSFAPAGAWKGREAERMEETQLHP
WVTKNGAELLPTEDENCTLVEVTEEEVENSVKHIPSLATVILVKTMIRKRSFGNPFEGSK
REERSLSSPGNLLPKQGSEDNLKCNDLPNVGEEELLS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgctcatcgtggtgaccgagcacgacgctgcggcgagcgcgagcgaggaggag
atggacgtgcccggcagcgacggtttcagagatggccgtaagctgcacctctccggccga
aagctgtccctgcaggagcggccgcagccggcgcgctcgcccggcaacggcgacggcgcc
aacgaacgcttcatctacccgtccctgccctactccccggtgacgtccccacactcctcc
ccgcggctgccacggcggcccacggtggagtccaaccgcgtgtccatcacgggactgcag
gactgtgtgcagctcaaccagtacaaactgaaggatgagattgggaagggctcctatggg
gtggtgaagctggcctacaatgaggacgataacacctactatgcaatgaaggttctctcc
aaaaagaagctgatgaggcaggcgggcttcccccgccgccctccgccccgtggggccaaa
gtggcctctgagggctgcctgcagcccagggggcccatcgagcaggtctaccaggagatt
gccatcctcaagaagctggaccaccccaatgtggtgaagctggtggaggtcctggatgac
cccagcgaggaccacctgtacatggtgtttgaactggtgaagcagggcccagtgatggaa
atcccaaccctgaaacctctcagcgaggaccaggctcggttctacttccaggatctgatc
aagggcatcgaatacttgcactatcagaagataatccatcgggatattaaaccttccaac
ctcctcgtgggggaagatgggcacgtcaagatcgccgactttggagtgagcaacgagttc
aagggagccgacgccctcttaaccaacacagtgggcacccctgccttcatggccccggag
acgctctccgaaaccaggaaaatcttctctggaaaggctttggatgtctgggccatgggg
atcacgctgtactgcttcgtgtttgggcagtgcccttttatggatgaaaggatcctgagt
ttacacaataaaatcaagacccaaacgttggagttcccggaccagccagaagttacggac
ttcctgaaggatttgattacacggatgttggataaaaatcccgaatctcgaatttcggtc
ccagaaatcaaggaaagtactgtgcaacagcctttcgcaggagatttctggtccttcgcc
cctgcaggagcctggaaggggcgagaagctgagaggatggaggagactcagttgcaccct
tgggtcaccaagaacggagcggagctgctgcccacggaggatgagaactgcaccctcgtt
gaggtgacggaagaggaggtggagaattcagtcaagcacatccccagcctggccaccgtg
atcttggttaagacgatgatccggaagcgatcctttgggaacccattcgaggggagcaag
agggaggagcggtcgctgtcctcccctgggaacctgctgccgaaacaaggcagcgaagat
aatctgaaatgcaacgacttgcccaacgtgggagaggaggaacttctttcatga

DBGET integrated database retrieval system