KEGG   Empidonax traillii (willow flycatcher): 114055125Help
Entry
114055125         CDS       T05887                                 

Gene name
PLK2
Definition
(RefSeq) serine/threonine-protein kinase PLK2
  KO
K08861  polo-like kinase 2 [EC:2.7.11.21]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    114055125 (PLK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etl01001]
    114055125 (PLK2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:etl03036]
    114055125 (PLK2)
Enzymes [BR:etl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     114055125 (PLK2)
Protein kinases [BR:etl01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   114055125 (PLK2)
Chromosome and associated proteins [BR:etl03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    114055125 (PLK2)
   Centrosome duplication proteins
    Regulators of centriole replication
     114055125 (PLK2)
  Sister chromatid separation proteins
   Polo kinases
    114055125 (PLK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr POLO_box Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-GeneID: 114055125
NCBI-ProteinID: XP_027734726
Position
Unknown
AA seq 663 aa AA seqDB search
MELLRTIAHPPGGGGAKCCEAAAGRAAGGESRRKKAEEPHQHGHPAAEVSRIITDPTTGK
RYCRGKVLGKGGFAKCYEMTDLTTNKVYAAKIIPHSRVAKPHQREKIDKEIELHRMLNHR
HVVQFYHYFEDRENIYILLEYCSRRSMAHILKARKVLTEPEVRYYLRQIVSGLKYLHEQE
ILHRDLKLGNFFINENMELKLGDFGLAARLEPLEHRRRTICGTPNYLSPEVLNKQGHGCE
SDIWALGCVMYTMLLGRPPFETTNLKETYRCIREARYSLPSSLLAPAKHLIASMLSKNPE
DRPSLDEIIRHEFFLQGFTPDRLSASCCHTIPDFHLSSPAKNFFKKAAAALFGGKKDKAR
YFDTHNKLSKEDEEIYRLRHDLKKTSITQQPPKHRTDEEIQPLITTVAKPGALPETKQIG
DSIRMIVRGTLGSCSSSSECLEDSTMGSVADTVARVLRGCLENMPEADSIPKEQLTASFQ
WVTKWVDYSNKYGFGYQLSDHTVGVLFNNGAHMSLLPDKKTVHYYAELGQCSVFSATEAP
EQFISQVTVLKYFSHYMEENLMDGGDLPSLTDVRRPRLYLLQWLKSDKALMMLFNDGTFQ
VNFYHDHTKVIICNQSEEYLLTYINEDRMSTTFRLTTLLVSGCSLELKHRMEYALNMLLQ
RYN
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggagctgctacggactatcgcgcacccgccgggcggcggcggtgccaagtgctgcgag
gcagcggcgggcagggcggccggcggcgagtcgcgcaggaagaaggcggaggagccgcac
caacacggccaccccgccgccgaggtctcccggattataaccgaccccacgacggggaag
cgctactgccgcggcaaggtgctcggaaagggtggatttgccaagtgttacgaaatgaca
gatttaacaacaaataaagtttatgctgcaaaaatcattcctcacagcagagtagcaaaa
cctcatcaaagggagaagattgataaagagattgagctgcacagaatgcttaaccataga
catgttgtgcagttttaccattattttgaagacagagagaatatttacattcttttggaa
tactgcagtagaaggtcaatggctcacatcttaaaagcaaggaaggtattgacagaacca
gaagtacgatactacctcaggcaaattgtgtcagggctaaagtatcttcatgaacaggaa
atcttacacagggatcttaaactaggtaacttcttcatcaatgagaacatggaactgaaa
ctgggtgactttggcttggcagctaggctggaaccactggagcataggaggagaacaata
tgtggcacaccaaattacctctctccagaagtcctcaacaaacaagggcacggctgtgaa
tctgatatctgggccttaggctgtgtaatgtatacaatgctgttgggaagacccccattt
gagactacaaatcttaaagaaacatacagatgtataagggaagcaagatacagcctacct
tcatctctcttggcacctgcaaaacatttaattgctagcatgttgtcaaaaaaccctgaa
gatcggcccagtttagatgaaataattcgacatgaattctttttacagggctttacacct
gatagactttctgctagctgttgtcacaccattcctgatttccatttgtcaagtcctgct
aaaaatttcttcaaaaaagcagctgctgcactctttggcggtaaaaaggataaagccaga
tactttgacacacataacaaactatctaaagaagatgaagaaatctacaggctcaggcat
gatttgaagaagacctcaataactcagcaaccccccaaacacagaacagatgaggagatc
cagcctcttatcacaacagtagcaaagccgggagcattgccagaaactaagcagattgga
gactctattcggatgatagtcagaggaactttgggaagctgcagcagtagcagtgaatgt
ctggaagacagtaccatgggaagtgttgctgatacagtcgcaagggtattgcgaggatgt
ctggagaacatgccagaagcagacagcattcccaaagaacagctgacagcatccttccaa
tgggttacaaaatgggtggactactctaacaagtatggctttgggtaccagctgtcagac
cacactgttggtgtccttttcaacaatggggcacatatgagccttctgccagacaaaaag
acagtgcactactatgctgagctaggccaatgctctgtcttctcagccacagaggctcct
gaacagttcattagccaagtaactgtactgaagtatttctctcactatatggaggagaac
ctcatggatggaggagacttgcccagcctaacagatgtacgcaggcctaggctttatctc
ttacagtggctcaaatctgataaagcattaatgatgctcttcaatgatggcacatttcag
gtgaatttctatcatgatcacacaaaagtcataatttgcaatcagagtgaggagtatctc
cttacatacatcaatgaagacaggatgtcaacaacttttcgtctgacaactcttttggtc
tctggatgttcattggaactaaaacacagaatggaatatgctctgaacatgctgctgcag
cgatataactga

DBGET integrated database retrieval system