KEGG   Empidonax traillii (willow flycatcher): 114055138Help
Entry
114055138         CDS       T05887                                 

Gene name
NSUN2
Definition
(RefSeq) tRNA (cytosine(34)-C(5))-methyltransferase
  KO
K15335  tRNA (cytosine34-C5)-methyltransferase [EC:2.1.1.203]
Organism
etl  Empidonax traillii (willow flycatcher)
Brite
KEGG Orthology (KO) [BR:etl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:etl03016]
    114055138 (NSUN2)
Enzymes [BR:etl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.203  tRNA (cytosine34-C5)-methyltransferase
     114055138 (NSUN2)
Transfer RNA biogenesis [BR:etl03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    114055138 (NSUN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltr_RsmB-F FtsJ
Motif
Other DBs
NCBI-GeneID: 114055138
NCBI-ProteinID: XP_027734753
Position
Unknown
AA seq 791 aa AA seqDB search
MGRRARDRRRQQQQQQRQERGGAGAGDQAGWAGGYPEIVKENELFERYYRELGIVPAGEW
DAFMAALREPLPATLRITGYRSHAKEILHCLKEKYFKELQDLEVDGQKVEMPQALSWYPE
ELAWHTNLSRKILRKSPQLEKFHQFLVSETECGNISRQEAVSMIPPLLLNVSPHHKILDM
CAAPGSKTAQLIEMLHADMNVPFPKGFVIANDVDNKRCYLLVHQAKRLNSPCIMVVNHDA
SSIPNLQIDVDGRKEILFYDRILCDVPCSGDGTMRKNIDVWKKWTTQNSLQLHGLQLRIA
TRGVEQLAEGGRMVYSTCSLNPIENEAVIASLLEKSQGALELADVSSELPGLKRMPGITK
WKVMLKDGQWFEEWQDVPTNRQTQIRPTMFPLKDEEKLKAMNLERCLRILPHHQNTGGFF
VAVLIKKSPMPWNKRQPKVHQKLPQGTGDTEVTATNSDNGSDCITEEPILAENEESKKMQ
GLQNSDTEQGKKEGVCGPPPSKKMKLFGFKEDPFVFLPEDDPLFLPIEKFYALDPSFPKM
NLLTRTQEGKKRQLYMVSKELRNVLLNNSEKMKVINTGIKVWSRNSDGEQFGCAFRLAQE
GIYTLYPFIHARIISVCIEDVKILLTQENPFLSKFSSETQKKVKDMAMGSVVLKYDPDPE
KPDDLQCPIVLCGWQGKTSLRAFVPKNERLHYLRMMGVEVFKAKRKEEGLENKTEEEVQH
KLAQTEEGMDVEDKEHDLVTKMEAEIGEESSQSPVESSAMEIENKTEDSDQSSKNATTHI
SKGTDTSNVKD
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgggccggcgggcgcgggaccgccggcggcagcagcagcagcagcagcggcaggagcgg
ggcggcgccggcgccggggaccaggcgggctgggccggcggctaccccgagatcgtgaag
gagaatgagctgttcgagcggtactaccgggagctaggcatcgtgcccgccggcgagtgg
gacgcgttcatggcggcgctgcgggagccgctgcccgccacgctgcgcatcacgggctac
cgcagccatgccaaagagattctccactgcttgaaggaaaaatacttcaaggagctgcag
gacctggaggtggatggtcaaaaggtcgagatgccacaagcactgagctggtatccagaa
gagttagcctggcacactaacttgagtagaaaaatcttacgcaagtccccacaactggaa
aagttccatcagtttctggttagcgagacagagtgtggaaatatcagtcgtcaggaggct
gttagtatgatcccacctctgctgcttaatgttagccctcatcataagattctagatatg
tgtgctgcacctggatctaagactgcacaacttatcgaaatgttgcatgcagacatgaat
gttccttttcccaagggttttgtaattgctaatgatgtcgacaacaagcgctgctatttg
ctggttcatcaggctaagagattaaacagtccgtgcatcatggtggtaaatcatgatgcc
tccagcattcctaatctacaaatagatgttgatggaagaaaagagatcctcttctatgac
aggattttatgtgacgtcccctgcagcggagatggaaccatgaggaaaaacattgatgta
tggaagaagtggacaacacaaaacagtttgcagctccatggcttgcagctgagaattgca
acccgtggtgttgaacagctggcagaaggtgggagaatggtgtattctacgtgttcattg
aatcctatcgaaaatgaagctgtgatcgcatctctgctggaaaaaagtcaaggtgcctta
gaacttgctgatgtctcttctgagttaccaggcttgaagaggatgccaggaattacaaaa
tggaaggtaatgctgaaagatggacagtggtttgaagagtggcaagatgtgcctacgaat
agacaaacacagatacgtcccactatgtttccattaaaagatgaagagaagctaaaggca
atgaatctagagcgttgtcttaggatattgccacatcaccagaacacaggcggtttcttt
gtggctgtgttaataaaaaaatctccaatgccctggaataaacgtcagcctaaggttcat
cagaagttaccacaaggaacaggagatactgaagtgacagcaactaattcagataatggt
tctgactgtattactgaggaaccaatacttgctgaaaatgaggagtctaagaaaatgcaa
ggattgcagaattcagacactgagcaaggcaaaaaggaaggagtatgtggaccaccaccg
tctaaaaaaatgaagttgtttggttttaaagaagacccttttgtctttctccctgaagat
gatccattgttccttcctatcgagaagttctatgcattggacccatcatttcccaagatg
aatttactgactcgaactcaagaaggaaagaagagacagctgtacatggtttctaaggag
ctgaggaacgtgcttctgaacaacagtgagaagatgaaggttattaacacaggcataaaa
gtctggtctcgcaacagtgatggtgaacagtttggatgtgcattccgattagcgcaggag
ggaatttatactctgtacccgttcattcatgcgaggattataagtgtctgcatagaagat
gttaaaattctgctaacccaggaaaatccattcttaagtaaatttagcagtgaaacacag
aagaaagtcaaagacatggcaatgggaagtgtagttctgaagtatgacccagaccctgaa
aaacctgatgatcttcagtgtcccatagtcttgtgtggttggcaaggaaagacgtcactt
cgtgcctttgtgcccaagaacgagagacttcattacctgaggatgatgggagttgaagtg
tttaaagcaaagaggaaagaggagggattggaaaacaaaactgaggaagaagttcaacat
aagctggcgcaaacagaggaaggaatggatgtggaagataaagaacacgatttagtcaca
aaaatggaagcagaaataggtgaagaatcttcccagagtcctgtggaaagcagtgctatg
gaaatagaaaataaaactgaggattcagatcaatctagtaaaaatgccaccactcacata
agcaaaggcacagatacaagtaatgtgaaagattag

DBGET integrated database retrieval system