KEGG   Empidonax traillii (willow flycatcher): 114055354Help
Entry
114055354         CDS       T05887                                 

Gene name
CACNA1I
Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1I isoform X1
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04010  MAPK signaling pathway
etl04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114055354 (CACNA1I)
   04020 Calcium signaling pathway
    114055354 (CACNA1I)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:etl04040]
    114055354 (CACNA1I)
Ion channels [BR:etl04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   114055354 (CACNA1I)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel DUF3043
Motif
Other DBs
NCBI-GeneID: 114055354
NCBI-ProteinID: XP_027735180
Position
Unknown
AA seq 2101 aa AA seqDB search
MMVILLNCVTLGMYQPCEDMDCLSDRCKILQVFDDFIFIFFAMEMVLKMVALGIFGKKCY
LGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVRVLRPLKAINRVPSMRILVNLLLDT
LPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCFMEENFTIQGDIVLPPYYQPEEDDEM
PFICSLSGDNGIMGCHEIPPLKERGHECCLDKDDYYYYNSVRQEFNISGMCVNWNQYYNV
CRTGNANPHKGAINFDNIGYAWIVIFQVITLEGWVEIMYYVMDAHSFYNFIYFILLIIVG
SFFMINLCLVVIATQFSETKQREHQLMQEQRVRYLSSSTVASYMEPGDCYEEIFQYVCHI
VRKAKRRTLGLYNSIQTWRQGNVETSDAKPGMNRKRQRHYRLCQQHNSLGCPPPGSVQPI
AVTATSDPTNCPRCHRGEHEASRRPSVLDSTYSDQENGGASEGEGEGSREDQDASTLEKE
EEVEEGGRLKLCSDMWREVRVKLRVIVDSKYFNRGIMIAILVNTISMGIEHHEQPEELTN
ILEISNVVFTSMFALEMILKLAAFGLFDYLRNPYNIFDSIIVIISIWEIIGQSDGGLSVL
RTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSL
RTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWASLYFVALMTFGN
YVLFNLLVAILVEGFQAEGDANRSYSDEDQSSSNVEEFDQFQEVQEGPDPKLCAIPVTPN
GHLDPSLPSSNPPVAAGGVTNSSRNSLQLDQILVAVGSRKSSVMSLGRMTYDQRSLSSSR
SSHYGAWGRSGAWGSRRSSWNSLARGHSLKHKHPSAEHESLLPGEAHRAADGETDGTGRV
LHHRRTLSLDNKGSCDLLELASVPSCHRVTHKLGAPPGASEHQDCNGKMPSIVKEIFPNM
NNRKERGEDDEEIDYSLCFRIRKMMEVYKPDWCELREDWSIYLFSPQNRFRLLCQTIIAH
KLFDHVVLAFIFLNCITIALERPQIEHRSTERIFLTVSNYIFTAIFVAEMTLKVVSLGLY
FGDQAYLRSSWNVLDGFLVFVSLIDIVVSVASAGGAKILGVLRVLRLLRTLRPLRVISRA
PGLKLVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDIRNITNRSDC
MAANYKWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNNNPWMLL
YFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRSKAQPKC
LFEAQRLPYYATYCPIRLLIHSVCTSHYLDIFITFIICLNVVTMSLEHYNQPVSLETALK
YCNYLFTTVFVFEAVLKLVAFGLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPIN
PTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVEL
FGKLVCNDENPCEGMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRDCSHDDRSCLS
NLQFISPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAELELEISHGLCS
RKSGSPNSGQGKGAGTGGDGGRTDPEGHLCMRCYSPAQENLWLDSVSLIIKDSFDGELMI
IDNLSGSVFHHYSSPAMCEKCNHDKQEVQLAEMEALSLNSDKSSSILLGDESDNRNTSQL
SPKQIKQDGQDSPDFSGAENLGECLLPATSENGSTNPDSYLCEMENTPLNTVQSWLKHET
TKVPPSPFSPGASCPLLPVPAEFFHPAMSATQTGPEKVSSPHNLPKISLQGSWASLRSPS
VNCSLLQQPPDSDTSLDSQSSSSAGSLQTTLEDSLNLSDSPQCTLDLPVALCPMPAAGSQ
RPLAAPLSPASRRRSLRGRGLFNLRSMCRHQRSHSSGGSTSPGCTHHDSMDPSDEEGAGS
SLRGGGNNSEPSETLSSLSLTSLFSPPPPGLTVVKKCSSTSSLHASPSPRRPPTHHTKPF
YTVDPRGFLSMPSWVTDFCKDTPSPREGEEIDGPGRLGTGGRSSPLPSELELGDGVSKRN
R
NT seq 6306 nt NT seq  +upstreamnt  +downstreamnt
atgatggtgattttgctaaactgtgttaccctgggaatgtaccagccatgtgaggatatg
gactgcctttctgacaggtgtaaaatcttgcaggtatttgatgatttcatcttcatcttc
tttgccatggaaatggtcttaaagatggttgccctggggatcttcggcaagaagtgttac
cttggagatacctggaaccgcctggatttcttcattgtcatggctgggatggtggagtac
tccctggatctccaaaacattaacttgtctgcaatccgtactgtccgtgtcctgagaccc
ctgaaagctatcaaccgtgtgcctagcatgcgcatccttgtgaacttgctcctggacacc
ttgcccatgctggggaacgtccttctcctctgcttctttgtcttcttcatctttggcatc
atcggggtgcagctgtgggctgggctgctccgcaaccgctgcttcatggaggagaacttc
acaatacaaggtgacattgtcttgcccccttattaccaaccagaggaagatgatgagatg
ccctttatctgctcactgtcaggagacaatggaattatgggctgtcatgaaataccccca
ctgaaggagcgaggtcatgagtgttgtttggacaaggatgattattattactacaattca
gtgcggcaagagttcaatatcagtggcatgtgtgtcaattggaaccagtactacaacgtg
tgccgtaccggcaacgccaacccgcacaagggtgccatcaactttgacaacattgggtat
gcctggattgtgatatttcaggtgatcacactggaagggtgggtggagatcatgtactat
gtgatggatgcacattccttctacaattttatctactttatcttgttgataatcgtgggc
tctttcttcatgattaacctgtgcctggtggtcatcgccacacagttctcggagaccaag
cagcgggagcaccagctgatgcaggagcagagggtccggtacctctcctccagcactgtc
gccagctacatggagccgggagactgctacgaggagatcttccaatacgtctgccacatc
gtgcgcaaagccaaacgccgcaccctcgggctgtacaacagcatccagacctggcgccag
ggcaacgtggagacgagcgacgccaaacctggcatgaacaggaaaagacagaggcattac
aggctttgccagcagcacaactctcttggctgccctcctccaggctcggtccagcctatt
gctgtgacagcaacctcagatcccaccaactgcccacgatgccacaggggggagcacgaa
gcatccagaaggccctctgtcctggatagtacttattcagaccaggagaatggaggagcc
agtgaaggggaaggagagggcagcagagaggaccaggatgcctcgacactggagaaagag
gaggaggtggaagaaggagggcggctgaagctctgcagtgacatgtggcgagaagtgagg
gtcaagctccgagtgattgtggacagcaagtatttcaaccgtgggatcatgattgcaatc
ctagtgaacactatcagcatgggcatcgagcaccatgaacagccagaggaactgaccaac
atcttggagatcagcaatgtggtctttacgagcatgtttgctctggagatgatcctgaaa
ctcgctgcttttggtctctttgattaccttcgcaacccctacaacatcttcgacagtatc
atcgtcatcatcagcatttgggagatcatcggccagtcagacgggggcctctctgtgctg
aggactttccgcctccttcgagtcctgaagctggtgcgtttcatgcctgctctgcgccgc
cagcttgtggtgctgatgaagactatggacaacgtagccaccttctgcatgctcctcatg
ctcttcatctttatattcagcatcctgggaatgcacatctttggttgcaagttcagcctc
aggacagacacaggagatacagttcctgaccgaaagaattttgactccctactttgggct
atcgtcactgtcttccagatcctaacccaggaggactggaatgtcgtactctataacggc
atggcctccacctcaccatgggcttccctctattttgtggctctcatgacatttggcaat
tatgtacttttcaatctgctggtggccattctcgtggaggggttccaagctgagggtgat
gccaaccggtcgtactcagatgaagaccagagttcatcaaacgtggaggagtttgatcag
tttcaagaggtccaggaaggcccagatcccaagctctgtgcaattcctgtaacacctaat
ggacacttggacccatccttgccctcttccaacccaccagtggctgctgggggggtcacc
aattcttcacgcaactccctacaacttgaccagatccttgttgctgttggatcccggaag
agcagtgtgatgtccctgggtagaatgacctatgaccagcggtccttgtccagctcccgc
agctcccactatggtgcctggggccgcagcggagcctgggggagccgtcgctccagctgg
aacagcctggcccgcggacacagcctgaaacacaaacatccctcagctgagcatgagtcc
ctcctgcctggggaagctcacagggcagcagatggggagacggatgggacaggaagggtg
ttgcatcaccgccggacactctctctggataacaaaggctcctgtgacctgctggagttg
gcctcggtcccatcctgccacagagtgacccataagctgggagcaccgcctggggccagt
gagcatcaggactgcaatggcaaaatgcccagtattgtcaaggagatcttcccaaatatg
aacaatcgcaaggagcggggagaggatgatgaagagatagattatagcctgtgctttcgc
atccggaagatgatggaagtctataagccagactggtgtgagttacgggaagactggtcc
atatatctcttctctccacaaaacaggtttcgcctcctgtgccaaaccatcattgctcac
aagctcttcgaccatgttgtgctggccttcatcttcctgaactgcatcacaattgccctg
gagagaccacagattgagcacagaagcacggagaggatctttctcactgtgtccaactac
attttcacagcaatttttgtagctgagatgacactgaaggtggtctctctaggcctgtat
tttggggaccaggcttatctccgcagcagttggaatgtcttggacggcttcttggtcttc
gtttctctcattgacattgtggtctcagtggcctctgctggcggtgccaaaatcctgggg
gtgctacgagttctccggctgctgcgcaccttacgtcccctccgagtcatcagtcgagcc
cctggcctgaagctggtggtggagacactcatttcttccctcaaacccataggaaacatt
gtcctcatctgctgcgctttcttcatcatctttggcatcctaggtgtgcagctcttcaag
ggcaagttctaccactgcctgggagtcgacatcaggaacatcaccaaccggtctgactgc
atggctgccaactacaagtgggtacaccacaagtataacttcgacaatctgggacaggct
ctgatgtccctctttgttctggcttccaaggatggctgggtcaatattatgtataatgga
ctagatgctgtggctgttgaccagcagccggtgaccaacaacaacccctggatgctactc
tacttcatctccttcctcctcattgtcagcttctttgtgctcaacatgtttgtgggggtg
gtggtggagaacttccacaagtgccggcagcaccaggaggctgaggaggcacgccggcgg
gaggagaagcgcttgcgacgcttggagaagaagcgaaggagtaaggcacagcctaagtgt
ttgtttgaggcgcagcgtttgccgtactatgctacctactgccccatacgcctccttatt
cattcggtctgcaccagccactatctggacatcttcatcactttcatcatctgcctcaac
gtggtcactatgtccttggagcactacaaccagcctgtgtccctggagaccgccctcaag
tactgcaactacctgttcaccaccgtctttgtgtttgaggcagtcctcaagctggtggca
tttggtctgcgacgattcttcaaagacaggtggaaccagctagacctggccattgtgcta
ctgtctgtcatgggcatcacgttggaagagattgaaatcaatgctgctctcccaattaac
cccactatcatccggatcatgagggtgctgcgtatcgcccgagtcctgaagctactgaag
atggccacaggaatgcgagcgctgctggataccgttgttcaagccctgccacaggtggga
aaccttggacttcttttcatgctcctctttttcatctacgctgctctgggagtggagctc
tttggaaaactggtatgcaatgatgagaacccctgtgagggcatgagccgccatgccacc
tttgagaacttcgggatggccttcctcacacttttccaggtgtccacaggcgacaactgg
aatgggatcatgaaggatactttgcgtgactgcagccacgatgaccggagctgcctcagc
aacctgcagttcatctccccactgtactttgtcagctttgtgctcacagcccagtttgtc
ctcatcaacgtggtggtagccgtgctcatgaaacatcttgacgacagcaacaaggaggcc
caggaggatgcagaaatggatgctgagcttgagctggaaatttctcatgggctgtgctcc
cgcaagtcaggctctccaaattcaggacagggaaaaggagcaggaacaggaggagatggt
ggtcgaacagatcctgaaggacatctgtgcatgagatgttactctccagcccaggagaac
ttatggctggacagtgtctctttaattattaaggactccttcgacggggagttaatgatc
atcgataacctatcgggctccgtcttccaccattactcctcgccggccatgtgcgagaag
tgtaaccatgacaagcaagaggtccagctggctgaaatggaagcattatccctcaactca
gacaagtcctcttccatccttctaggagatgagtcagacaatcgaaacacttctcagctg
agtcctaagcagatcaagcaggatggccaggacagccctgacttcagtggggcagaaaat
cttggggaatgcctgctcccagcaaccagtgagaatggctctacaaacccagacagttac
ctatgtgaaatggagaatactcctttaaacacagtccagtcttggctaaagcatgaaact
accaaagtccctcccagccccttctctccaggtgcatcttgccccctgttacctgtacca
gcagaatttttccacccagccatgtctgccacccagacagggcctgagaaggtctcgagt
ccacataaccttcctaagatctctctgcaaggctcatgggcatcactgaggtctccaagc
gtgaactgttcacttcttcaacagccgcctgacagtgatacgtcgctggacagccagagc
agcagctcggcaggcagcctgcagaccacgctggaggacagcctcaatctcagcgactct
ccccagtgcaccctggacctcccggtggccctgtgtcccatgccagctgcgggcagccaa
agacccctggcagcccccctctcccctgcctcccgccgccggagcctgcggggccggggg
ctcttcaacctgcgaagtatgtgtcgtcatcagcgcagccacagcagcggtgggagcacc
agtcctggctgcactcaccatgactccatggacccctctgatgaagagggggcgggcagc
agcctgcgggggggtggcaacaacagcgagccctcggagaccctcagcagcctctcgctg
acctccctcttctcacccccaccaccagggctgaccgtggtgaagaagtgcagcagcacc
agcagcctccacgccagcccctcgccccgccgcccccccacccaccacaccaagcccttc
tacaccgttgacccccggggcttcctctcaatgccgtcctgggtgacagacttctgcaag
gacaccccctcacccagggaaggagaggagatagacggccctggcagactggggacaggg
ggccgcagctccccgctcccttctgagctggagctgggcgatggtgtcagcaagagaaac
agatga

DBGET integrated database retrieval system