KEGG   Empidonax traillii (willow flycatcher): 114056465Help
Entry
114056465         CDS       T05887                                 

Definition
(RefSeq) cytosolic phospholipase A2 epsilon-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl00564  Glycerophospholipid metabolism
etl00565  Ether lipid metabolism
etl00590  Arachidonic acid metabolism
etl00591  Linoleic acid metabolism
etl00592  alpha-Linolenic acid metabolism
etl01100  Metabolic pathways
etl04010  MAPK signaling pathway
etl04217  Necroptosis
etl04270  Vascular smooth muscle contraction
etl04370  VEGF signaling pathway
etl04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    114056465
   00565 Ether lipid metabolism
    114056465
   00590 Arachidonic acid metabolism
    114056465
   00591 Linoleic acid metabolism
    114056465
   00592 alpha-Linolenic acid metabolism
    114056465
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114056465
   04370 VEGF signaling pathway
    114056465
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    114056465
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    114056465
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    114056465
Enzymes [BR:etl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     114056465
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 114056465
NCBI-ProteinID: XP_027737476
Position
Unknown
AA seq 862 aa AA seqDB search
MTQELLPMEVPEALYYMNPGKTMMSSKAKGLEGDGDSDFNSWRDGGPQEKKDETTMPDKG
DFKIESSPCYLLTVRIIRMRNLQRVDAFSQADCYVSLWLPTATCEKSRTKTVRNSNNPVW
NETFYFRIQSQVKNVLELTVYDEDFATPDDHLLCAIFDTAKLPIERTVVLYFKPSPNAKE
ELEVEFKLESASGPHEMIATNGVLVCRELCCLEVEVAEKMKQKSKKELSLTVKGSFEGTQ
DITLGPNGVVSPSCPTKFHYIKYAEPTLDVMLPKKRRYHPLSCKFSTDTGSPVVMLNSLP
MGRKTTIAEEKRFDLNVTAQACNCSCHQDLDMRFGFDLCSEEKAFLGKRKRYVASALKTV
FHLPQELQDQEVPVVAIITTGGGLKSMTGLYGSLMGLKKLNLLDCVTYISGLSGTTWTMA
NLYRDAYWSQKDLDSHIGEAQKQATKCKMGCFSMDRMKYYNKQLCQRKEEGYRTSFIDLW
GLMIEYLLNDGKDPHKLSEQQEALCDGQNPLPIYVAVSVRDSYSTNDFKEWVEFTPYEVG
LLKYGAFVRTENFGSEFFMGRLLKKLPESRICYLQGMWSSIFSVNLLQIWGLSHSSEDFW
KRWTQDRIEEVDEDPVLPTRPHELRTRMYTPPGPLSSALRGALTDRFSVAQHHNFLKGYQ
LHNNYMENEHFCQWKDTVLDSRPNQLVQNPDQLGMIDAGFFINTSSAPLLRPQREVDVII
YLSYTTGSHTSSLDKACKYYSEQKIPFPKVSFTDEEKKNLKECYLFHDSDLPGCPIVIFL
PLVNDTFQEYKAPGVKRCCSEMEEGQLDLTSCCSPYCMFSVRYTDENYRKLLNLSEYNIL
NNSDVIMQALQIAMERRRQKMC
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgacccaagaattgttgcccatggaggtgccagaagcgctctattacatgaatccaggg
aagaccatgatgtcatcaaaggcaaaaggactagagggagatggagactcagacttcaat
tcttggagagatggtggacctcaagaaaagaaagacgaaactactatgccagacaaaggt
gatttcaagatagaatcctctccctgctacctgttgaccgtaaggatcatccggatgaga
aatctccagcgagtggatgcctttagccaggctgattgctacgtctcattgtggctgcca
actgctacatgtgaaaagtcacgcactaaaactgtgagaaactccaacaatccagtgtgg
aatgaaaccttctacttccgaatccagagtcaggtcaagaatgtgctggagctgacagtg
tatgatgaggattttgctactccagatgaccatctcctctgtgcaatctttgatactgct
aaacttccaattgaaagaacagtggtcctgtactttaagcctagcccaaatgccaaggag
gagctagaggttgaattcaagctggagtccgcttctggtcctcatgaaatgattgctacc
aacggagtgctggtgtgtcgcgaactttgctgcttggaagttgaagtggcagagaagatg
aagcaaaaatcaaagaaagagctttccctcactgtgaagggctcctttgaggggacacag
gatatcacgctgggccccaacggagtggtcagcccatcatgtcccaccaagttccactac
atcaagtacgcagagccaacactggatgtcatgttgccaaagaagaggcgctaccaccct
ttgtcctgtaagttcagtacagacacgggctccccagtcgtgatgctgaattcactgccc
atgggaaggaaaacaaccattgcagaggagaaaagatttgacttaaatgtgacagcacaa
gcctgtaattgttcttgccaccaagacctggacatgcgctttgggttcgacttatgttca
gaagaaaaggctttcctggggaaaagaaagagatacgtagcaagtgccctcaaaactgtt
tttcacctaccacaggaactgcaggatcaagaggtccccgttgtggctatcatcacgaca
ggcggaggactgaagtcaatgacaggactgtatggcagcctcatgggactcaagaaatta
aatctcctggactgcgtaacatatatcagtgggctgtccggcaccacatggaccatggcc
aacttatacagagatgcctactggtcacagaaagacctggactcacatattggtgaagcc
cagaaacaagcaacaaaatgcaagatgggctgtttctctatggatcgcatgaagtactac
aacaagcagctttgtcagcggaaagaagagggatacaggacatcatttatagatctttgg
ggtctcatgattgagtacttgctaaatgatgggaaagaccctcacaaactttcagagcag
caagaagcactctgtgatggccagaacccactgccgatctatgtggcagtcagtgtccgg
gacagttacagcaccaatgatttcaaagagtgggtggagttcaccccctatgaggtggga
cttctgaagtacggcgcattcgttcgcacagagaattttggaagcgagttcttcatggga
cgcttgttaaaaaagctccctgaatcccgcatctgctaccttcaaggtatgtggagcagt
atattttctgtgaacctgttacaaatatggggactttcccacagttcagaggacttctgg
aagaggtggacacaagacagaatagaagaagttgatgaagaccccgtgttgcccacaagg
ccccatgagctgaggactcgcatgtacactcctcctggccccttgtccagtgccctacgg
ggagctttgactgatcgtttctccgtcgcccagcaccacaatttcctgaagggctaccag
ctgcataacaactacatggagaatgagcacttctgtcaatggaaagacactgtgttagac
tcacgtcccaaccagctggtgcaaaatcctgatcaactgggcatgatagatgctggattt
ttcatcaataccagcagtgcaccacttttaaggccacagagggaagtggatgtcatcata
tatctaagttatacgactggatcacatacatcgtctctagataaggcgtgtaaatactac
tcggagcagaaaatcccattccccaaagtttctttcactgacgaagaaaagaaaaatctg
aaggagtgctacctcttccacgattcagatttgccaggatgtccgattgtgatttttctt
ccccttgtgaatgatactttccaagagtacaaagcacctggagtcaagcgctgttgctca
gagatggaggaaggacaacttgatttgaccagctgctgttccccctactgcatgttctcg
gtcaggtacaccgatgaaaattaccgcaagctgctgaatctcagcgaatacaacatcctg
aacaattctgacgtgattatgcaggccttgcagatagcaatggaaaggagaaggcagaag
atgtgctga

DBGET integrated database retrieval system