KEGG   Empidonax traillii (willow flycatcher): 114057424Help
Entry
114057424         CDS       T05887                                 

Gene name
DOCK8
Definition
(RefSeq) dedicator of cytokinesis protein 8 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
etl  Empidonax traillii (willow flycatcher)
Brite
KEGG Orthology (KO) [BR:etl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:etl04131]
    114057424 (DOCK8)
Membrane trafficking [BR:etl04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    114057424 (DOCK8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N GPR15L
Motif
Other DBs
NCBI-GeneID: 114057424
NCBI-ProteinID: XP_027739487
Position
Unknown
AA seq 2105 aa AA seqDB search
MATLPAADRRAFALKINRHSSAEIRKQFTLQPGFAQFCQRSLSTPGFSALHLPSFYDAVE
PVDFEGFLMTQLNNLDSELAQELGDFPEDDLDVLFTPKECRTLQPSVPEDGVELDSHVRD
CVQTYIREWLIVNRKNQGNSDTCSLKNRGSRKDFHKTLQKQTFESETLDSGDANFQVGPQ
HIHALPEEASRTTLASSYFELRSLQPDPRLENLLRHVSAEEFERQNEEARRTNRHPELLA
LYPSVDEEHAVEIRPVPDRPKEHLGNRILVKLQTLKFDIEIEPLFACIALYDIKERKKIS
ENFHCDLNSDSLRGFLRSHTPSIDLSTQARSAVFSVTYPSSDIYLVIKIEKVLQQGEIGD
CAEPYMVLKESEAGKTKEKIEKLKAQAESFCQRLGKYRMPFAWIPISLTNFFNLSTLERE
IPDTEGLNGKGSTSDKRATLLQARRLSERSLGSEDSYPASNFKTISLTLGTFFKQEGDRL
SDEDLFKFLADFKRSSSLQRRVKTLPGTLKLEISPAPENLSYCLTPELLPVKPFPENRNR
PHKEILEFPIREVYVPHTIYRNLLYVYPQRLNFANRLASARNITIKIQFMCGEDPSCAMP
IIFGKSSGPEFVQEIYTAITYHNKSPDFYEEVKIKLPAKLTEKHHLLFTFYHISCQPKQG
ASVETLLGYSWLPILLNDRLQTGHYSLPVALDKLPLHYSIHSPEKMPSQTPPIKWVEGHK
SVFIVEVQAVSSVHTQDNHLEKFFTLCHSLESQVTFPIRVMDQKITEASLEHELKLSIIC
LNSSRLEPLVLFLHLVLDKLFQLAVQPMVIAGQTANFSQFAFESVVAIVNSLHNSKELSK
DQHGRNCLLASYVYYVFRLPEPQREVVKPGAGSSAISTESRYYTFGRTSAVSVGSKLLQS
RVISCSNPDITITQTAADEEVKNIMSSKPMDHSSSRMSYYVEGTNDMSSICANPRPSNKK
HFHEELALQMVVSTGMVRESVFKYAWFFFELLIKSMAQYVHNIEKQDNPRRTRFSDRFKD
DITTIVSVITSEIAALLVKPPKESEQAEKINISLAFFLYDLLSLMDRGFVFNLIKHYCNQ
LSNKLNSLSTLISMRLEFLRILCSHEHYLNLNFFFMTPASAPASPSPSLSSQNSSSCSSF
QDQKITGMFDLSAEYRQQHFLTGLLFTELAAALDADSEGISKVQRKAVSAILSLLSSHDL
DPRCSKKEVKIKIAALYLPLVGIILDSLPQLHDFTISESRSAKGRTGNPEEEQESAGTIN
QNVALAIAGNQFNIRNSGIPLVSLPYRQSATLGPETTRNLLICFLWIMKNADQNLIQKWI
ADLPPMQLNRILDLLFICVSCFEYKGKQTSDKVSTQALQKSRDVKARLEEALLRGEGARG
EMMKRCRIPAGNDRSTGLNENLRWRKEQTQWRQANERQDKTKAELDQEALISGNLATEAN
LIILDMQENIIQASFAAECRDNLLGGVLKVLVNSLGFDQSTTYLTHCFATLRALIAKFGD
LLFEEEVEQCADLCQRVLHHCSSSIDITRTQACATLYLLMRYSFSSSSNFARVKMQVTMS
LASLVGKSPEFNEEFLRRSLRTILAYAEEDMDMQATPFPIQVEELLCNLNSILSDTVKMR
EFQEDPEMLMDLMYRIAKGYQTSPDLRLTWLQNMAEKHTKRKCYTEAAMCLVHAAALVAE
YLSMLEDRNYLPVGSVSFQNISSNVLEESAVSDDVLSPDEDGIYSGRYFSESGLVGLLEQ
AAELFSTGGLYETVNEVYKIVIPILEAHRDFRKLTLTHSKLQKAFDSIINKGQKRMFGTY
FRVGFYGSKFGDLDEQEFVYKEPAITKLPEISHRLEGFYGQCFGEDAVEVIKDSAPVDRR
KLDPNKAYIQITFVEPYFDEYEMKDRVTYFEKNFNICRFMYTTPFTKDGRPRGELSEQYK
RNTILTTMHAFPYIKTRINVLEREEFVLTPIEVAIEDMRKKTQELTAATNQEPPDAKMLQ
MVLQGSVGATVNQGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNKQL
ITADQREYHQELKRNYMKLKENLRPMIERKIPELYKPVVKVHSTRESFRNHSFRKYDVQT
SSQST
NT seq 6318 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccttacccgccgcggacaggagggcgttcgccctgaaaatcaacaggcactcc
tctgcagaaataagaaagcagtttactctccaaccaggctttgcacagttctgtcaacga
agcttaagtacccctggcttttctgcacttcatctgccttccttttacgacgcagtagaa
ccagtagattttgaaggcttcctaatgacacagctgaacaacttggactcagaactggca
caggaacttggggattttcctgaagatgacctggacgttctctttacaccgaaagagtgc
aggactttgcaaccttctgtgcccgaagatggggttgaactggactcacatgtcagagac
tgtgttcagacatatatccgtgagtggctgattgtgaatcgaaagaaccaagggaattca
gatacttgtagcctgaaaaacaggggatcccgaaaagattttcacaagacgcttcaaaaa
cagacatttgaatcagaaacattggattctggcgatgcaaatttccaggtgggaccccaa
cacatccatgctctccctgaggaggcctccaggacaaccctcgcctcctcttactttgag
ctccgcagcctgcagccagacccccgcttggagaacctgctgcggcacgtcagtgccgag
gagtttgagaggcagaacgaggaggcgcggcgcaccaacaggcaccccgagctccttgcc
ctctacccctctgtggatgaggaacatgcagtggagatacggccagtgccagatcgcccg
aaggaacatctgggcaacaggattttggtgaaactgcagactctgaagtttgatatagag
attgaacctttatttgcatgcatagctctctatgacataaaggaaagaaaaaagatctca
gaaaattttcactgcgacctcaactctgactcattaagaggattcttgcgttctcataca
ccctcgattgacttgtctactcaggcaagatcggcagtattttctgtcacttatccctca
tcagatatatacctggtaatcaagatagaaaaagtgcttcagcaaggagaaattggagac
tgtgcagaaccctatatggttcttaaagaaagtgaggctggcaagacaaaagaaaagatt
gaaaaactgaaagcacaagctgaatccttttgtcagcggttggggaaatacagaatgcca
ttcgcctggattcccataagcctaactaatttcttcaacctttcaacacttgaacgagaa
atacctgacactgaaggtttaaacgggaagggatccactagtgacaagagggcaacactg
ctgcaggcaagaagactttctgagagaagtcttggctcagaggacagctatccagcatcc
aatttcaaaacaatctctctgacccttggcaccttctttaaacaggaaggagacaggctc
agtgatgaagatctcttcaaatttttagctgatttcaaaagatcgtcttccttgcaaaga
cgagttaagactttaccaggaacacttaaactggagatttccccagctccagaaaacctt
agttattgtctgacaccggaactactgccagtgaagccatttccagaaaaccgtaatcgt
ccccacaaagagattttggaattcccaattagagaagtgtatgttccccatactatttat
agaaatctcctctatgtttaccctcagaggctgaattttgctaaccgactggcttctgca
agaaacattaccatcaagatacagtttatgtgtggtgaagatccttcctgtgcaatgccg
ataatttttgggaaatcttcaggtccagaatttgtccaagaaatatacacagctatcaca
tatcataataagtcccctgacttttacgaagaagtgaaaattaagctgccagcaaaactc
acagagaaacatcatctactgttcacattttatcacatcagctgccaaccaaagcaagga
gcatctgtggaaaccctcctagggtactcatggctgccgattctattaaatgatcgtctt
caaactggacattatagtcttcctgttgcattggataagctgcctttacactattcgatt
cactctcctgagaaaatgccatctcagacaccacctattaagtgggttgaaggacacaaa
agtgttttcattgttgaagtgcaagctgtttcatctgttcatactcaggacaaccacctg
gagaagttcttcactttgtgccattctctggaaagtcaagtgacattccccattcgagtg
atggatcagaagattacagaggcttcactggaacatgaattgaaactcagcattatttgt
ttaaattcttcacgccttgaacctcttgtcttgtttttgcatttggtactagacaaactt
ttccagctggctgtgcagcccatggtcatagctggccagacagccaatttctcacagttt
gcctttgaatctgtggttgcaatagtgaacagtcttcacaacagcaaagagctgagcaaa
gatcagcatgggaggaattgcctcctggcatcttatgtgtactacgtatttcgtctgcca
gaacctcaaagagaagtggtcaaaccaggtgcaggtagcagtgccatttcgacggagtct
cgctattacacatttggacgcacttcggcagtgtctgttggaagtaaactcctgcagagc
cgagtgatcagctgcagcaatcctgacatcactattacacaaactgctgctgatgaggag
gtcaaaaacatcatgtcatccaagcctatggatcacagctccagtcggatgtcttactac
gttgaagggacaaatgacatgtcaagtatttgtgcaaacccaagaccttccaataaaaag
catttccacgaggagctagcactgcagatggtggtcagtacaggcatggtgagagaatct
gtcttcaagtacgcctggttcttctttgagctcctgataaaaagtatggctcagtatgtt
cataacatagagaagcaagacaacccacgaagaactcggttctctgatcgcttcaaagat
gatattactactatagttagtgtgattacttcagagattgctgcacttttagtcaaacca
ccaaaagaaagcgaacaagcagaaaaaattaatatcagcctggcatttttcctgtatgat
cttctttctttaatggaccgaggatttgtgtttaatctcatcaagcattactgcaatcag
ctttcaaacaagctgaattcactctccaccctgatttctatgaggcttgagttcctgaga
attctctgcagccatgagcattacctcaatctgaacttcttcttcatgacacctgcatct
gctccagcatctccttctccttccttatcctcccagaactccagctcctgctcaagtttc
caggaccagaaaatcactggtatgtttgacctctcagccgaatatcgccagcaacacttc
ctgactggtttacttttcactgaattggcagcagcactggacgcagacagtgaggggatt
agcaaggtgcaaagaaaagctgtcagtgctatccttagcctgctgagttcccatgacctt
gatccacgttgctccaaaaaagaggtgaagattaaaattgcagctctttacctccctttg
gttggtataatcttggattcactaccacaactccatgattttacaatttcagaaagccgc
agcgcaaagggacgcacaggaaacccagaagaagaacaagagtctgcaggtacaatcaac
caaaacgtggcccttgccattgcagggaatcagttcaacatcaggaactctggaatacct
ctggtgtccctgccctacagacagagtgccacattaggtcctgaaactactcgcaatctt
ttgatctgtttcctctggatcatgaagaatgctgatcagaatctaatacagaaatggatt
gcagaccttccacccatgcagttgaacagaattttagacctcctcttcatttgtgtctca
tgctttgagtacaagggcaagcaaacctcagataaagttagcacccaggcactccagaag
tcccgagatgttaaagcccgattagaagaggctttactgagaggtgaaggagccagagga
gaaatgatgaagcgctgcagaataccagctgggaatgacagatcaacggggctaaatgaa
aacctgcgctggagaaaggagcagactcagtggcggcaggcaaatgagaggcaagataag
accaaagctgagctggatcaagaagccctgatcagtggaaacttggcaactgaagctaac
ctgatcattcttgatatgcaagagaacatcatccaggcaagctttgcggcagagtgcaga
gataatcttttgggaggagttttgaaggtcctggtaaattctcttggcttcgatcagagc
actacttatctcactcattgctttgctacactcagagcactcatagccaagtttggggat
ctgctgtttgaagaggaggttgaacagtgtgctgacctgtgtcaaagagttctccatcac
tgcagcagcagcatagatattacacggactcaagcctgtgccactctctatctcctcatg
agatacagtttcagctctagcagtaattttgcaagagtgaagatgcaggtgaccatgtca
ctagcttctctggttggaaaatcacctgagtttaatgaggaattccttcgacggtcctta
cggactatcctagcctatgcagaggaagatatggatatgcaggcaactccatttcccatc
caggtagaggagctactgtgtaatctgaacagcatcctgtcagatacggtgaaaatgagg
gaatttcaggaagatccggagatgctgatggacctcatgtacagaattgcaaagggatac
caaacgtcaccagacttgaggctgacttggctgcagaacatggcagagaagcacaccaag
aggaagtgctacacagaagcagccatgtgcttggtccatgctgcagcactggtggcagag
tacctgagcatgcttgaggatcgaaactatctcccagtgggcagtgtcagctttcagaac
atttcatccaatgtgctggaggaatctgctgtttcagatgatgttttgtctccagatgag
gatggcatatattctggaaggtatttctcagaaagtggactggtagggctgctggaacaa
gctgcagagctcttcagcacgggaggattgtatgaaactgtgaatgaggtgtacaaaatc
gtcattcccatactggaggcacatcgagactttaggaagcttactttgacacacagcaag
ctacagaaggcctttgacagcataattaataagggtcaaaaacgaatgtttggaacttac
ttccgagttggtttctatggatccaaatttggggacttagatgaacaggaatttgtttat
aaggagcctgcaattaccaagcttcctgagatttctcacagattagagggattttatggc
cagtgttttggagaggatgctgtggaagtgattaaggactctgctcctgttgacagaaga
aagctggaccccaataaggcatacatacaaattacttttgtagagccatattttgatgag
tatgaaatgaaggacagagttacctattttgagaagaacttcaacatctgtcggttcatg
tacactacgcctttcaccaaggatgggcgccccagaggagagcttagtgagcagtacaag
aggaacaccatcctaaccacaatgcatgctttcccctacatcaaaactagaatcaatgtc
cttgaaagagaagagtttgttttaaccccaattgaagttgctatagaagatatgcgtaaa
aaaacacaggaactaactgcagccaccaaccaagaaccaccagatgccaaaatgctccag
atggttttgcagggctcagttggagccactgtaaatcagggaccgctagaggtagcacaa
gtgttcctggccgaaattccagcagaccccaagctttatcgacatcacaacaagctgagg
ttgtgtttcaaagagtttatcatgagatgtggtgaagcagtggagaaaaacaagcaactt
attactgctgaccagcgggaatatcatcaagagctcaaaaggaactacatgaagctgaag
gagaaccttaggcccatgattgagaggaagattccagagctctacaaacctgtagtgaaa
gtccatagcacaagggaatcttttcgtaaccacagttttaggaaatatgatgtccagact
tcttcacaaagcacctaa

DBGET integrated database retrieval system