KEGG   Empidonax traillii (willow flycatcher): 114057695Help
Entry
114057695         CDS       T05887                                 

Definition
(RefSeq) histamine N-methyltransferase-like isoform X1
  KO
K00546  histamine N-methyltransferase [EC:2.1.1.8]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl00340  Histidine metabolism
etl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    114057695
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etl04147]
    114057695
Enzymes [BR:etl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.8  histamine N-methyltransferase
     114057695
Exosome [BR:etl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   114057695
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_12 Methyltransf_31 NodS Methyltransf_11 DsrC
Motif
Other DBs
NCBI-GeneID: 114057695
NCBI-ProteinID: XP_027740122
Position
Unknown
AA seq 292 aa AA seqDB search
MASPMRNLLTDPDRYLQSFRLFLEKSTEHQSMREFMERQLPDVIASIGNGKSTINVLSVG
GGAGEMDLLILSKIQARYPGVTINNEAVEPSADQISKYKERVAQTSNLGNIKFTWHKETA
YEYESRMKAEKKSKKWDFIHMIQMLYYVRDVPATVRYFHSLLESQGKLLIILVSGKSGWD
TLWKKYASSFPLDDLCTYISSGDLPKMLDSAGLKYQLYELPSHMDITSCFIEGDKEGELL
LDFLTETLEFSKTAPPELKRQLMEELRKPGCSENRDGKVLFNNSLGVIVIDP
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgcccatgaggaacttgctcaccgaccccgacagatacctccagtcgttccgc
ctgttcctggagaagtcgacggagcatcagagcatgcgggagttcatggagaggcagctg
ccggatgtgatagcgagtattggaaatgggaaatctacaatcaatgttctaagcgttggt
ggtggagcaggtgagatggacctgctgatcctctcaaaaatacaagccagatatcccggg
gtcaccatcaacaatgaggcggtagagccaagtgctgaccaaatctccaagtacaaagag
cgtgtggctcagacatcaaaccttgggaacataaagtttacctggcacaaggagacagct
tatgaatatgaaagtcgaatgaaagcagaaaagaagtctaaaaagtgggacttcattcac
atgatccagatgctgtactatgtgagagatgtcccagcaactgtccggtatttccacagc
ctcctggaatcgcagggaaagctcctcattatcctggtgtcaggaaagagtggctgggac
acgctgtggaagaagtatgcatcttccttccctttggatgatctctgcacttatatctcc
tctggtgacttgccaaagatgctggattcagcagggctgaagtaccagctctacgagctc
ccatcccacatggacataacgagctgctttattgaaggggacaaagagggggagttgttg
ctagatttcctgacagaaacacttgagttttctaaaactgctcctcctgaactaaagcgt
cagttaatggaagagctgagaaagcctggatgcagtgaaaacagagatgggaaggtgctt
ttcaataacagcctgggtgtaatagtgattgacccgtga

DBGET integrated database retrieval system