KEGG   Empidonax traillii (willow flycatcher): 114057812Help
Entry
114057812         CDS       T05887                                 

Gene name
MRVI1
Definition
(RefSeq) protein MRVI1 isoform X1
  KO
K12337  inositol 1,4,5-triphosphate receptor-associated cGMP kinase substrate
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:etl00001]
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    114057812 (MRVI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRVI1 PEP-utilisers_N
Motif
Other DBs
NCBI-GeneID: 114057812
NCBI-ProteinID: XP_027740330
Position
Unknown
AA seq 846 aa AA seqDB search
MPTSPEDKGQAQEAQHSSSPPAKDTAVGGTTCSTPSIVLPENALTPDAEIDKNLVNRSRS
PHRRHSNRANRNSTSSLTSVDNSGHVIDLVNDQLPDVKISEEDKKKNLELLEEAKKVSER
FLMRRGRKSRSSLPESPTAVSPTLSPKVSPVASRSNSLTLPVPSGSDACTATSIESVSPG
QNNRTVKEDDRQTAENAAKGLTDRRQNDQRKISQGRLVPRSAGFENSKEKLSDQKENFDP
HKHMDTLPKCSPSGGDGGRMSLNPCMNVCENELGKSFLKKGKENDVPFRTHLPGAGIGNM
DSKLKMPVPEMRDHKVSGKPEFKLCGLRPPLLRAVSWDSLEPGQKEKTPSKLPSEEDKSF
AGNKPSNQLKAFKDLQIQVQPVRMQKLTKLREEHILMRNQNLVGLKLPELSEAAEQEKGP
SPLPSPTEEEETKNSSDVMPSIPDVLLRKLRVHKSLPGSSPPLTEKEVENVFVQLSLAFR
NDSYTLESRINQAERERNLTEENAEKELENFKAAITSSAHLWHHYEHREAYQKLLEDIAV
LRRLAARLSSRAEMVGAVRQEKRMSKATEVMMQYVENLKRTYEKDHAELMEFKKLANQNS
SRSYGASEDGVPRSSRSMSLTVGKNMPRRRVSVAVVPKFNSLNIPGQSPTASPIPSMPSL
SESPSNGRSSLTSSPALPALLENGKSNGEPDCETSPSVLSQSGLEEISPETKAKIEEEAY
NKGYQEGLKKTKELQELKEEDEETPKESHDEHEESENEDEIKNLKSSRLEVIINYLYILY
PKLCKHWNVVWLVVAAIIIFAVVLGIYHSYNSCDEKSEGAEGKASCSAAHQYSWWNSGFR
HEQRTE
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atgccaacctcacctgaagacaagggacaagcacaagaggcacagcacagcagttctcct
ccagccaaagacactgcagttggagggacaacatgcagcaccccttctattgttcttcca
gagaatgctcttacaccagatgcagaaattgataaaaatctggttaacaggtctcgtagt
cctcacaggagacattctaaccgtgccaataggaattctacaagttccttgacttctgtt
gacaacagcgggcacgtgattgacctggtaaatgatcagctaccagatgtcaagatatca
gaggaagacaaaaagaagaaccttgagctactagaagaggcaaagaaagtgagtgagagg
tttctaatgcgcagaggcagaaagtcgaggagcagcctgccagagtcacccacagcagtt
tcccctactcttagtcctaaagtttcaccagtagcatctcggagcaactctctcactctt
ccagttccatcagggtctgatgcttgcacagccactagtattgaatctgtatctccaggg
cagaataacagaactgtgaaagaggatgacaggcaaactgcagagaatgctgcaaaagga
ttaactgatcgaaggcagaatgatcaaagaaagatttctcagggaaggttggttcctcgt
tctgctggttttgaaaactccaaagagaagctgtctgaccaaaaagaaaactttgatcca
cataaacatatggatactttacctaaatgctccccttcaggtggtgatggtggtagaatg
tctcttaatccttgcatgaacgtttgtgaaaatgaacttggaaaatcattcctcaagaaa
ggaaaagaaaatgatgttcctttcagaacccatctaccaggagcagggataggaaatatg
gactccaagctaaaaatgcctgttccagaaatgagggaccataaagtttcaggtaaaccg
gaattcaaactgtgtggactgcgtcctcctctactacgggctgtgtcatgggacagcttg
gagcctgggcagaaggagaaaacaccttcaaaattaccatctgaggaagataaaagcttt
gctggcaataaacccagcaatcagttaaaagccttcaaagaccttcaaatccaagttcaa
ccagttcgaatgcagaagttaacaaagctcagagaggagcatattttgatgagaaatcaa
aatttagttggacttaaacttcctgaacttagtgaagcagccgaacaggaaaaaggccct
tcacctctcccttcccccactgaagaggaagagacaaagaatagctctgacgtcatgccc
agcattcctgatgtattgctgcgaaaactgcgagtgcacaaatcgcttccaggaagctcc
cctccacttactgaaaaagaagttgagaatgtgtttgtacaactttccttggcctttaga
aatgatagttacacattggaatctagaattaaccaagcagagagagagagaaaccttaca
gaagagaatgctgagaaggaactggaaaactttaaagcagccattacgtcctcagctcac
ctgtggcaccactatgagcacagggaagcctaccagaagctgctggaggacatcgctgtc
ctgcggcgtttggctgccaggctgtcgagtcgcgccgagatggtgggagccgttcgccag
gagaaacgcatgtcaaaagcaacagaagtaatgatgcagtatgtggaaaatctgaaaaga
acatatgaaaaggatcatgctgaactaatggagttcaagaaacttgccaatcagaattcc
agcagaagctatggtgcatctgaagatggagtgcctcgttcatcgagatccatgtctctt
actgttggaaagaatatgcctcggaggagagtcagtgttgcagttgttcctaagtttaac
tccttgaacattcctggtcagtcaccaacagcttcacctataccttcaatgccatccctg
tctgaatcgcctagtaatggaaggagcagcctaacatctagtcctgctctgccagcactt
ctagaaaatggaaagtctaatggggaacctgactgtgaaacctccccatctgtgctgtca
cagagtgggttggaagagatcagccctgaaactaaagccaagatagaagaggaagcatat
aacaaaggctatcaggaaggcttaaagaaaaccaaagaacttcaagaactgaaggaagaa
gatgaagagacacccaaagaaagtcatgatgaacacgaagaaagtgaaaatgaagatgag
attaaaaacctgaaaagcagcagacttgaagtcatcattaactatttatatatactgtac
cccaaactgtgcaaacactggaacgtggtttggctcgtagtggctgcaatcatcattttt
gccgtggtgttgggaatctaccattcctacaactcctgcgatgagaagtccgagggagct
gaagggaaggccagctgctctgctgcccaccagtattcctggtggaactcagggtttcga
cacgagcaacgcaccgaataa

DBGET integrated database retrieval system