KEGG   Empidonax traillii (willow flycatcher): 114058057Help
Entry
114058057         CDS       T05887                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 13C-like
  KO
K05151  tumor necrosis factor receptor superfamily member 13C
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04060  Cytokine-cytokine receptor interaction
etl04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114058057
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    114058057
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:etl04050]
    114058057
   04090 CD molecules [BR:etl04090]
    114058057
Cytokine receptors [BR:etl04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   114058057
CD molecules [BR:etl04090]
 Proteins
  114058057
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BaffR-Tall_bind
Motif
Other DBs
NCBI-GeneID: 114058057
NCBI-ProteinID: XP_027740828
Position
Unknown
AA seq 206 aa AA seqDB search
MQELGSRLHSAMSSSGKAAIASSCLSFECFDSLTKACIKCSELYKDNTTEPTLAPTLTST
FLIFGVPLAVGFILILAALCGFLACKVGKWRRKSKAADEEDKANMETASPLPSQDPAMPE
GDGALDPDPCPHLDGGLKMLGPPRKARAKQRPCCQDNADGDIILLSTVYPRHEECNHSFP
LPATELGATALVTTKTTQNCAREERI
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcaggagctgggctctcgcttacattcggccatgtcctcatcaggaaaagctgccatt
gcctcctcctgcctctccttcgagtgcttcgattccctgaccaaggcatgcatcaagtgc
tccgagttgtacaaggacaacacaacagagcccaccctggcacccaccctgaccagcact
ttcctgatcttcggggtcccgttggcagtggggttcatcctgattctggctgccctctgt
ggcttcctggcctgcaaggtgggaaagtggaggaggaagagtaaggcagcagatgaagag
gacaaagcaaacatggaaactgccagccccctgcccagccaagaccctgccatgccagag
ggagatggtgccctggacccagacccatgcccgcatcttgatgggggcctgaagatgctg
gggccacccaggaaagctagggcaaaacagaggccatgctgccaggacaatgctgatggt
gacatcattctgctctccactgtgtacccccggcatgaggaatgcaaccacagcttccca
ctgcctgccactgagctgggggccacagccctggtcaccaccaaaaccactcagaactgt
gccagagaggagcgaatctga

DBGET integrated database retrieval system