KEGG   Empidonax traillii (willow flycatcher): 114058967
Entry
114058967         CDS       T05887                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
etl  Empidonax traillii (willow flycatcher)
Brite
KEGG Orthology (KO) [BR:etl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:etl03000]
    114058967 (AHRR)
Transcription factors [BR:etl03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    114058967 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_11 PAS_9 PAS_4 Herpes_U5
Other DBs
NCBI-GeneID: 114058967
NCBI-ProteinID: XP_027742691
Position
Unknown
AA seq 759 aa
MIPPGECLYAGRKRRKPIQKQRPAVGNEKSNPSKRHRDRLNAELDHLASLLPFPPDIVSK
LDKLSVLRLSVSYLRVKSFFQAIQEKHFKKQVGQTIKEDNISNKTAVQEGGLLLESLNGF
ALVVSADGMIFYASSTIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMNPPQMLS
GQQSQTETGEEYILSKLFKAQENDSMTTDYSSFLTRCFICRVRCLLDSTSGFLTMQFQGK
LKFLFGQRKKSSSGTVLPPQLSLFCIVVPLLLPSVTEMKMKSLLVKAKHKADDSTAANTN
SSSKGSSGLCEATELYGRNSHHEGAAFTNALQIAENQIKAKNNGENGISLVKVQTNEDHW
VWVQANTQLLYRSGCSEYVLAQQQMLKEEDEQLKILSGFASLKGNLEGLSRNSAIETLGQ
WKHLNWTAVKNEQDNVKLKFEPHTNGECFMQEEPLSSNTSVLGIQNNCTANSSWNLRNSS
SCSMSQRINSCSNRRAASFYNRDQNFLNLTSTCPSHWGSVENSQSYSGVQQRCAETYMTD
HLKLQRPLISSESLYDTAVPLEMPIKMEYDSDSENTADNYLMSQNRAWLDENSSVRKQVC
SYPGRVHLKMEPDLCEPALPCQKPRHCLYTPHNWQCIVANHPNNLNLNRSCKGSRNREVA
PFCPQNSSMCLESMPDLPHTACYGHFYSPSPGEEKEQNNEVFKMPCEFKNPCLVQAIKRE
PLDSPPLSNSGQNRVHVSFPENTLAGPVPHKTTECTFLQ
NT seq 2280 nt   +upstreamnt  +downstreamnt
atgattcctccaggggaatgcctatatgctgggagaaaaaggaggaaacccattcagaaa
caaaggcctgcagtcgggaatgaaaaatcgaatccttcgaagagacacagggaccgtctg
aacgcggaactggaccatctggccagcctcctgccttttccacctgacattgtatcaaag
ctggacaaactttccgtcttgcgcctaagtgtcagctatctccgagtcaaaagtttcttt
caagccattcaagaaaagcactttaagaagcaagttggccaaacaataaaagaagacaat
atatctaacaagactgctgtacaagaaggtggacttctactagaatcactgaatggtttt
gcattggtggtgagtgcagatggaatgatattttatgcatcatctacaattgtggactat
ctagggtttcatcagactgatgtaatgcaccaaaacatatatgattacattcatgtggat
gatcgccaggatttctgtagacaactgcactgggccatgaaccctccccagatgttgtct
ggacagcaatcacagacagaaacaggagaagaatatattctcagtaaattgtttaaagca
caagagaatgacagcatgacaacagattattcttccttcttaactcgctgtttcatctgt
cgagttcgctgcttgttggacagtacttctggcttccttacaatgcaattccaaggcaaa
ctaaagtttctctttggacaaaggaagaagtcctcatcaggaacagtactgccacctcag
ctgtccttattctgcatagtggtaccgcttctgctcccttctgtgacggagatgaagatg
aaaagcctgcttgtgaaagcaaaacacaaagctgatgattcaacagcagcaaacacaaac
tccagttcaaaaggcagttcagggctgtgtgaagcaacagaattatatggaagaaacagt
caccatgaaggtgccgctttcactaatgcattacagattgctgaaaaccaaatcaaagca
aagaataacggagaaaatggcatttctctagtcaaagtacaaacaaatgaagatcactgg
gtctgggttcaagctaacactcaacttctgtatcgaagtggttgttcagaatatgtcctt
gcccaacagcaaatgttaaaggaagaagatgaacaactgaagatactaagcggttttgcc
agtttgaaaggaaacctggagggtctttcccgtaacagtgccattgaaactctgggtcag
tggaagcatcttaactggacagcagtaaaaaatgaacaagataatgtaaaattgaagttt
gagcctcatactaacggtgagtgtttcatgcaagaggaacctctcagttctaacacttca
gttttaggcattcaaaacaactgcacagcaaacagcagctggaatttaagaaactcgagc
tcttgttctatgagccagcgaataaactcgtgttcaaacaggagagctgcatcattctac
aacagagaccagaatttcttaaatttgacatcaacttgtccttcccactggggaagtgta
gaaaacagccagtcttactcgggcgtccagcagcgctgtgcagagacctatatgacagac
catctgaaacttcagagaccattgatatcttcagagtctctctatgacaccgccgttccc
ttggagatgcctatcaaaatggaatatgattctgattctgaaaacactgctgacaactac
ttgatgtcgcaaaaccgagcatggctggatgagaacagctcggtgagaaagcaggtgtgt
agctaccccggtagagtgcatctcaaaatggaaccggacctttgtgagccagccttgcct
tgtcagaagccaaggcactgcctttacacaccacacaactggcaatgcattgtagcaaat
catccaaacaacctaaacttgaacagatcctgcaagggttcacgtaacagggaggtggcc
cctttttgccctcagaactcctccatgtgtctggaaagcatgcctgacttgccacacacg
gcttgctacggccatttctacagccccagcccaggggaggagaaagagcagaataatgag
gtgttcaaaatgccgtgtgaatttaaaaacccctgcttggttcaagcaatcaagcgtgag
cccctggattctccaccattgtccaacagcggacagaacagagtacatgtgagcttccct
gaaaatacattagcaggtcccgtgcctcataaaaccactgaatgtacatttttgcaatag

DBGET integrated database retrieval system