KEGG   Empidonax traillii (willow flycatcher): 114059081
Entry
114059081         CDS       T05887                                 

Gene name
ADAMTS13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13 isoform X1
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
etl  Empidonax traillii (willow flycatcher)
Brite
KEGG Orthology (KO) [BR:etl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:etl01002]
    114059081 (ADAMTS13)
Enzymes [BR:etl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     114059081 (ADAMTS13)
Peptidases and inhibitors [BR:etl01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   114059081 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS ADAM_CR_2 Reprolysin TSP_1 ADAM_spacer1 TSP1_spondin Reprolysin_4 Reprolysin_5 Reprolysin_3 TSP1_CCN Reprolysin_2 Peptidase_M10 DUF3810
Other DBs
NCBI-GeneID: 114059081
NCBI-ProteinID: XP_027742901
Position
Unknown
AA seq 1398 aa
MMVGWAVRALVMLPLGLCWPREKFLSALDAEAVFSYFGTSSVADVPEFVVAEPTCPCKEE
QVGLTLCGIQRCSIEAWGELFAFEFLEDHALLSPSFVSSQVVNSSFSFLKRFPGNCFAGG
HPLQPPGATSRVTYCEGQLQGVVAVDEEKIHIVPVRSKDVALLKDLGFSRPHILFRSAAG
EAKTARAGRGPPRLQKRAEGAVKHLELMVVAGPDVFSYHREDTERYILANLNIGAELLRD
ASLGAHFRVHLMQMLVLREPEAELNITTNITSSLISVCEWSTKVNPQNDSDPQHADIVLY
ITRFDLELPDGNKELRGVTQLGGVCSSFWSCVITQDTGFDLGVTIAHEIGHSLGISHDGE
GNQCSSSGYIMGSAGNHNSIDLTWSPCSREQFLALVSTGQTSCLNDLPDMDGSIPGWKPG
LYYGADEQCKIAFGSVATACTFADSNVDICKVLSCHVQPTDKSSCTRLLVPLLDGTECGI
NKWCSKGQCSSLEELNPMAVVHGQWSAWSPFSPCSRSCGGGVVVRQRFCNNPRPAFGGQE
CRGASVQAEMCNTQACLTTQQDFMAEQCAATNLKPLYLTVETPSFYNWTSAVGFAKGDLL
CKHMCRAIEKEFMVSRGDSFTDGTRCEHEDSEHHGPFHLCIMGSCRAFGCDGQMDSEKIM
DSCKVCGGDNSTCTQVRGSYMEGKAKEYVTFLSLPYNTTSVHVTNRRPLFTHLAVKVKGE
YVVAGKGKISQNVTHPSVLEDNQIRYKVFLTKDNLPSLEEIHVDGPTREEIEIQVYRRYS
KEYGNATNPDITFSYSVPRENLTYLWIPQQGPCSVTCGEGTRPVVHVCFDQTKTEITEDQ
WCQELPRPLPEHKPCAMEQCLYRWKMSQRDECSAVCGTGVAQQNLTCVQFRDGLETVVDD
SLCPAEEKPLSLVPCVVSVCPLGWDKEEDAHLLQPLESLGHIPLENRTVYVWSPVAGECS
VSCGRGKTQLQYVCVAFDTKEETQEENCHPVPKPESRMEVCDLSPCPPRWKVTPAGPCSS
SCGLGLAVQLVTCVQIRQGKEVLQEEHLCPVAEKPPTSVPCVIRTCSYEWGFSEWSECSA
SCGNGIQTRRDFCLHSQTRRHVDPVFCRRFPKAIVVRGCSSGPCPEQLGTRSPGAELQPV
TPATHLTAAAAGREERYKGLDLPPSAVPREQTKTGGGVCGNLFLNATGIINMLGVQSSDC
TVAIGRPLGEEITLRILESSLNCSAGEVVLFSGRMMWRTGCRKLPLSLINSRTNTLIVKQ
RVVLPGNGVILQYSSRTATKKYYQDCDKQLFGPQGEIVNPVQLPDQRQEYVCRTFIDVAP
QHRIAIRALYTDLGTGGNHTHFNYILVRDVSTMKTMVFHGKQQFLWQSTGSQAEIEFHDN
VKDHPINFWAEYHAIEHK
NT seq 4197 nt   +upstreamnt  +downstreamnt
atgatggtgggctgggcggtgcgggcgctggtgatgctcccgctggggctgtgctggccc
cgagagaaattcctcagtgctctggatgcagaagctgttttttcctattttggaaccagc
tcggtggctgatgtacctgagtttgttgtggctgagccaacttgtccttgcaaagaagag
caggttgggctgacgctctgtgggatccagcgctgctccatcgaggcctggggagagctc
tttgcctttgaatttctggaggaccacgccctcctttccccatcctttgtgagcagtcaa
gtggtgaactcctcctttagcttcctgaagagattcccagggaactgctttgcaggtgga
caccccctgcagcctcctggggccacgagcagagtcacttactgtgaagggcagctgcaa
ggagttgttgctgtggatgaggaaaagatccacatcgtgccagtgagaagcaaagatgtg
gctctgctcaaggatcttggcttctccagaccccacattctcttcagaagtgctgcagga
gaggcaaagacagcaagagcagggcggggtcctcctcgcctgcagaagagggctgaggga
gctgtcaaacatctggagctgatggtggtggccggtccagatgttttctcataccacaga
gaggacacagagcgatacattcttgccaacctgaacatcggagcagagctgctcagggat
gcctcactgggggctcatttcagggttcatcttatgcaaatgctggttttgagggagcca
gaggcagagctgaacatcaccacgaacatcacctcctcgctgatcagcgtttgtgagtgg
agcacgaaggtgaacccccagaacgactctgacccccagcacgctgacattgtcctctac
atcaccaggtttgacctggagttacctgatgggaacaaggagttacgtggagtgacccag
ttagggggagtctgctcctcattctggagctgtgtgattacccaggacactggctttgac
cttggagtcaccatagcccatgagattgggcacagccttggaatctcccacgatggagag
ggcaatcagtgcagcagcagtggttacatcatgggttcagcaggaaaccacaacagcatc
gacctcacgtggtcaccgtgcagtcgggaacagttcctggcccttgtcagtacaggccaa
acaagctgcttgaatgacctgccggacatggacggcagcatccctggatggaagcctggc
ttgtactacggagcagatgagcaatgtaaaatagcctttgggagtgttgccacagcttgc
acctttgctgacagcaatgttgacatatgtaaagttctctcgtgccatgtacaaccaaca
gacaagtccagctgtactcggcttctggttcccctcttggatggaacggagtgtgggatc
aataagtggtgctccaagggccagtgcagctctctggaagaactgaaccccatggctgtg
gtccatgggcagtggtcagcctggagccccttctccccctgctcccgcagctgcggcggc
ggagtcgtggtgaggcagcggttttgcaacaaccccaggcctgcttttggggggcaggaa
tgccgcggtgccagcgtccaagcggagatgtgcaacacccaggcctgtctgactacccag
caggactttatggctgaacaatgtgcagcaacaaatttaaagccattgtatcttactgta
gaaacaccgtccttttataactggacttctgctgttggctttgccaaaggggacctgctc
tgcaagcacatgtgcagggccattgagaaggaattcatggtgagccgtggggacagtttc
acagatggaaccaggtgtgagcacgaggactctgagcaccacgggcctttccatctctgc
ataatgggaagctgcagagcattcgggtgtgacggccagatggactctgagaagataatg
gattcctgcaaggtctgtgggggtgataactccacctgcacccaagtgcgtggatcttac
atggaaggaaaagctaaagagtatgtgacattcctgtccctgccctacaacaccacctct
gtccacgttaccaaccggagacctctcttcacacacctcgctgtgaaggttaaaggagag
tatgtggttgctggaaaaggaaaaatctcgcagaatgtcacccacccgtcagtcctggag
gacaaccagatcagatacaaagtgttcctcaccaaggacaacctgccaagcctggaggaa
atccatgtggatgggccaacacgagaagaaattgaaatacaggtctacagaaggtactca
aaagaatatggcaatgccaccaacccagacatcaccttcagctactctgtccccagagag
aatctgacttatctgtggattcctcagcagggaccgtgttcagtgacctgtggggaaggg
acacgaccagtggttcatgtctgctttgatcagacaaagactgaaatcacagaggatcag
tggtgtcaggagctcccacggccccttccagagcacaagccctgtgccatggagcagtgc
ctgtacaggtggaagatgtctcagagagatgaatgctctgctgtctgtggaactggagtt
gcccagcagaatctgacctgtgttcagtttcgtgatggattggagactgtggtggatgac
agcctgtgcccagcagaggaaaagcccctctcccttgtgccctgtgtggtcagtgtctgc
cctttaggatgggacaaagaggaagatgcacacttgcttcagcctctggagtcgcttggg
catatcccactggaaaatcggactgtgtatgtctggagccctgtagctggagagtgttct
gtctcctgtggtagaggtaagactcagctgcagtatgtttgtgtggcttttgacaccaaa
gaagaaacccaagaagaaaactgtcatccagtgccaaagccagagagcaggatggaagtc
tgtgatctcagtccctgcccaccaaggtggaaggtgaccccagctgggccctgctcctcc
agctgtgggctcggcttagctgtgcagctggtcacctgtgtgcagatccgccaaggcaag
gaggttttgcaggaggaacatttgtgccccgtggcagagaagccccccaccagtgtcccc
tgtgtcatcagaacgtgctcttacgagtggggcttcagcgagtggtcagagtgctcagcc
tcctgtgggaatggcattcagacacggcgggatttctgcctccactcgcagacccgcagg
cacgtggaccccgttttctgccgccgcttccccaaggccatcgtggtgcgtggctgctcc
tcggggccctgtcctgagcagctggggaccaggtcccctggggcagagctgcagccggtg
acaccagccacacacctgacagcagctgcagctggcagggaggagagatacaagggcctg
gacctgcctccgtctgctgtgcctcgggagcagacaaagaccggcggaggtgtctgtgga
aacctgtttctcaatgccactgggatcatcaacatgttgggtgtgcagagcagcgactgc
accgtggccattgggcggcccctcggggaggagatcacactcaggatcctggagagctcc
ctcaactgcagcgcaggtgaggtagtgctgttttctgggcggatgatgtggcggacaggc
tgcaggaagctccctttgtccctgataaattccagaacgaacacactgattgtgaaacag
cgagttgtgctgccaggaaacggggtcattcttcagtacagcagcagaactgcaactaaa
aaatattaccaagactgtgacaagcagctgtttggtccccaaggtgaaatagtgaatcct
gtgcagttgcctgaccaaaggcaagaatacgtgtgccggaccttcatcgacgtggctccc
cagcaccgcatagccatccgtgccctctacactgacctgggcactgggggcaaccacaca
cacttcaactacatcctggtccgtgatgtgagcaccatgaagacgatggtgttccatggg
aaacagcaattcctctggcagtcaacaggcagccaagctgaaattgaattccatgacaat
gttaaggatcacccaatcaatttctgggctgaatatcacgctattgagcacaaataa

DBGET integrated database retrieval system