KEGG   Empidonax traillii (willow flycatcher): 114061503Help
Entry
114061503         CDS       T05887                                 

Definition
(RefSeq) T-box-containing protein TBX6L
  KO
K10180  T-box protein 6
Organism
etl  Empidonax traillii (willow flycatcher)
Brite
KEGG Orthology (KO) [BR:etl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:etl03000]
    114061503
   03019 Messenger RNA biogenesis [BR:etl03019]
    114061503
Transcription factors [BR:etl03000]
 Eukaryotic type
  Other transcription factors
   T-box
    114061503
Messenger RNA biogenesis [BR:etl03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     114061503
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: T-box
Motif
Other DBs
NCBI-GeneID: 114061503
NCBI-ProteinID: XP_027747839
Position
Unknown
AA seq 449 aa AA seqDB search
MQALPDVKAPCEALPSPSLEPYAQSSIVVTLEDMDLWMKFHQIGTEMIITKSGRRMFPQC
KIKVSGLIPYAKYLMLVDFVPMDNFRYKWNKDQWEVAGKAEPQLPCRTYVHPDSPAPGSH
WMKEPVSFQKLKLTNNTLDQHGHIILHSMHRYKPRFHIVQADDLFSVRWSIFQVFSFPET
VFTSVTAYQNEQITKLKIDNNPFAKGFREHGKNTRREGRAKCQKPSPAKSQKRKLPEEKE
PGAEERDFEKDENVDVKEESNPVVVSSGYPFWGSEQSGSQAFPAASPVPAEGLAREQQVP
TPSYQTYRFHEAGDSQHLPTRDATALNDFRARCHALDLATVPEHDSKQLPEGFTNLPPLP
PPLPPPQDYTGVVNMALDSVGKPGARAPVYSPYGTEQGLGQWVVPPHSQYRAMSYSAFST
EYNTQGAPGHAHGTMAEWSQYPLFPYACW
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctttaccagacgtgaaagcgccgtgtgaggcccttccttcccccagcctggag
ccctacgcacagagctccatcgtggtcaccctcgaggacatggatctctggatgaagttt
catcagattggaactgagatgatcatcaccaaatccggcagacgaatgtttccacaatgc
aaaatcaaagtctctggcttaatcccatacgccaagtacctcatgctggtagattttgtg
ccaatggacaacttcaggtacaagtggaataaagatcagtgggaggttgctgggaaagca
gagccccagctcccttgtcgcacctacgttcacccagattccccagctcctggcagccac
tggatgaaagaacctgtctccttccaaaaactgaagctcaccaacaacactctggatcaa
catggacatatcatcctgcactccatgcaccgttacaagccgcgcttccacattgtgcag
gcagacgacctcttcagtgtccgctggagcatcttccaggtcttcagcttccctgagact
gtcttcacttctgtcactgcctaccagaacgagcagattacgaagctcaagattgacaac
aatccatttgctaaaggtttccgtgaacatgggaagaacactcgaagggaaggacgagcc
aaatgccagaagcccagtccagccaagagccagaagaggaagctgcctgaggaaaaggag
cctggtgctgaggaacgtgattttgagaaggatgagaatgtagacgtgaaggaagagagt
aaccccgtggtggtcagcagtggatatcccttctggggctcggagcagagcggcagccag
gccttccctgcggcatcgccggtgcctgcagagggtctggccagggagcagcaagtgcca
acgccatcctaccagacatatcggttccacgaagctggggacagccagcaccttcccacc
cgcgatgccacggccttgaacgatttccgggcaaggtgccacgccttggatctcgccacg
gtgcccgagcacgactccaaacagctcccagagggcttcaccaacctgcctccgctcccc
ccgcctctgcctcctccccaggactacacaggggtggtgaacatggctctagactctgtc
gggaagccgggggcccgagcgcccgtgtacagtccctatggcaccgagcagggcctgggg
cagtgggtggtgcccccccacagccagtacagggcaatgagctactcggccttctccacg
gagtacaacacacagggcgctccgggacatgcccacgggaccatggcggagtggagccag
taccctctgttcccctacgcctgctggtga

DBGET integrated database retrieval system