KEGG   Empidonax traillii (willow flycatcher): 114061614Help
Entry
114061614         CDS       T05887                                 

Gene name
ACOX3
Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase 3
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl00071  Fatty acid degradation
etl00410  beta-Alanine metabolism
etl00592  alpha-Linolenic acid metabolism
etl00640  Propanoate metabolism
etl01040  Biosynthesis of unsaturated fatty acids
etl01100  Metabolic pathways
etl01212  Fatty acid metabolism
etl03320  PPAR signaling pathway
etl04146  Peroxisome
Module
etl_M00087  beta-Oxidation
etl_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:etl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    114061614 (ACOX3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    114061614 (ACOX3)
   00592 alpha-Linolenic acid metabolism
    114061614 (ACOX3)
   01040 Biosynthesis of unsaturated fatty acids
    114061614 (ACOX3)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    114061614 (ACOX3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    114061614 (ACOX3)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    114061614 (ACOX3)
Enzymes [BR:etl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     114061614 (ACOX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_ox_N Acyl-CoA_dh_1 Acyl-CoA_dh_2
Motif
Other DBs
NCBI-GeneID: 114061614
NCBI-ProteinID: XP_027748065
Position
Unknown
AA seq 706 aa AA seqDB search
MASTTNQKEATGNQNSWDSLLPDLPKGPLCRYRKKASFNWKEMAVFLDGEDIIQFKNRIF
SALESDPLFAHHPGEELSREKYQELTFLRCKRLFEYDFLTQQEIMENPLKVLNMVVCVGM
YDWSPCLQFVLHSGVFGGAIMSAYKKFAHILKQAYRMEIFGCFALTELSHGTNTKAIRTT
ATFDRNTQEFIINTPDFEAAKFWVGNMGKHATHAVLYAQLYTPDGQCQGLHSFLVQIRDT
KTLLPMPGVMVGDIGKKIGQNGLDNGFAMFHNVRIPKENILNIAGDVTAEGKYSSSVKDV
KEHFSAALGALSPGRIMITAVSTTNLKLALAIAIRFSAARRQFGPTEDEEIPVLEYQTQQ
WRLLPYLAAAYALDYFSKSLFENYVEFYAGVLTQQRSQRQADLGREIHALSAASKPLASW
TAQQAAQECREACGGHGYLAMNRLGEIRNDNDPNCTYEGDNNVLLQQTSNYLMSWMNCIR
DKAPFESPLGTINVLQDYHHILGWKFTAISVEDCMDSSVPLAAYKWLVCYLLQESDLKLG
KEKQAGLSDFEAKNNCQVYYCRSLAIAFIEQTVLQRYHDYTHDPSIPPALQPVLKNLSAL
YGLWSLSKHLAVLYQGGYASGEQPGRLIQNAILELCYRLKDNAVALVDVFAPPDFILNSP
IGKASGELYKNIWGEILQGNKALNRPPWWAEFCINKPVTGRLGSRL
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggcatccacaacgaatcagaaagaagccactggcaaccaaaattcatgggatagtttg
ctaccagatttacctaaaggcccgctttgcagataccgtaagaaagcttctttcaactgg
aaagagatggcagtgttcctagatggcgaagatatcatccaatttaagaacagaatcttc
tctgctctggaaagtgatcctctgtttgcacatcatcctggagaagaactgagccgtgag
aaatatcaggagctgacatttctgcgctgtaaaaggctctttgagtatgattttcttact
caacaagagatcatggagaacccattaaaggtccttaatatggtggtctgtgtaggaatg
tacgattggtctccatgtctccagtttgtcttgcatagcggtgtatttggaggtgcaatc
atgagtgcttataagaagtttgcacacattctgaaacaagcttatagaatggagattttt
ggatgttttgctctgactgagctcagccatggaactaataccaaagccatacgaactact
gccacatttgatcgtaacactcaggaatttatcatcaatacacctgactttgaagctgca
aagttctgggttggtaatatgggaaaacatgccactcacgcagttttgtatgcccagctc
tatactcctgatggacagtgccaaggattgcattcttttcttgtacagattcgagataca
aaaactctcctaccaatgccaggtgtgatggtaggggacataggaaagaaaattgggcaa
aatgggttggataatggatttgccatgttccacaacgtcaggatacctaaagaaaacata
ctgaatatagctggagatgtcacagctgaggggaaatactcaagctcagtcaaggatgtt
aaagagcatttcagtgcagctctgggagccttgtcccctggcaggattatgatcacagcc
gtttccacgaccaatttaaagctcgccttggcaatagccattcgcttctcagcagctcgc
cgccagtttggaccaactgaggatgaagaaatacctgttcttgaataccaaacacagcaa
tggcgtcttcttccttacctagccgctgcatatgccttagattatttctccaagtccctg
tttgagaactacgtagagttttatgcaggagtgttgacacagcaaaggagtcagagacag
gctgatttgggacgtgagattcatgctttatctgctgccagcaaaccactggcatcttgg
actgctcaacaggcagcccaggagtgccgagaagcttgtggaggacatggttaccttgcc
atgaatcgtctgggtgaaatccgaaatgacaatgatccaaactgcacatatgagggagat
aacaacgtcctccttcagcaaaccagcaactacttaatgagctggatgaactgcataaga
gataaagctccttttgaatcccctttgggaacaataaacgttttgcaagactaccatcat
atccttggctggaaattcacagctattagtgttgaagattgcatggactcctcagttcct
ttagcagcttataaatggctggtttgctacctgctccaagaaagtgacctaaaactggga
aaggaaaagcaggctgggctaagtgattttgaggcaaaaaacaattgtcaggtgtactac
tgtcgatccttagccattgcctttattgaacaaacagtcttacagcggtatcacgactac
actcacgaccccagcattccacctgcgctgcagccagtgcttaagaatctcagtgctctc
tatggactctggtctttaagtaaacacctggccgtgctctaccaaggtggctatgcttca
ggtgaacaacctggtagacttattcagaatgccattctggagctctgctacaggttgaaa
gataatgccgttgccctggttgatgtctttgctcctcccgacttcattctcaattctccc
attggtaaagctagtggagagttatataaaaatatctggggagagatccttcaaggcaac
aaagctctgaacagacctccatggtgggcagaattttgtattaataaacctgttacaggc
aggctggggtcaagattgtaa

DBGET integrated database retrieval system