KEGG   Empidonax traillii (willow flycatcher): 114063079Help
Entry
114063079         CDS       T05887                                 

Gene name
PARP9
Definition
(RefSeq) protein mono-ADP-ribosyltransferase PARP9 isoform X1
  KO
K15260  poly [ADP-ribose] polymerase 9 [EC:2.4.2.30]
Organism
etl  Empidonax traillii (willow flycatcher)
Brite
KEGG Orthology (KO) [BR:etl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    114063079 (PARP9)
Enzymes [BR:etl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     114063079 (PARP9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Macro PARP
Motif
Other DBs
NCBI-GeneID: 114063079
NCBI-ProteinID: XP_027750902
Position
Unknown
AA seq 845 aa AA seqDB search
MIAAAFAFVSRSLHSVPRPGPCPSSGRRGAHGSAAPSRSMGAIQGYFARTSEEKIGLGSS
MVMDEVSLMMPINKDAYEAFKRRDSCLSNLISQKFACVLTFKSTLEVYRKELKGIDICVC
KGDLTRHKVDALVNAANEFLQHKGSLALALVAAGGSEIQEESNFFVQKYGRLRVGDIAVT
GAGKLPCKAIIHAVGPKWDASEKEKCCRLLDKAIMNILHYVSAPQSAIKSVAIPAVSSGV
LGFPLELCVQVIVMAVRQFVEVPPPSLLREIRLVNIDEATVAEIKKACEKFLNDTSSLQG
TVSSSPSQSLTSITCGGIHLRITRGYLDEQETTAVVNRIFKRGNPPSPFSRLLQKAGPGL
QKELNNCLIFSTHYKELIVTEGYDLPCEFVLHVVLKEHELLVLQYEELKHAVKRCLSQDE
QCCSISFPVKWSLKLPVDIVAEAMIEEVLNFARAHPEKKREVQFVVCPDDYIAYQVFQRK
FYSAKHRLENRSDPLSTESGIQSIKDTANEEKVIAITGRTRTAVEAAESWLQRVVQIQEG
RHAVIKNNYIFCLGKNEFAELYQDMPSSVCVSEEVRGGKATLEFKGPPDALIDAVLTTEN
LLLRMQEKTIAEQKKLLHSMCQPEAGQLSEEDLHNANITTSIKILPVESNLQEFKDRQKQ
FEKAGLHVLKIEKIHNPLLSDAFQQMKKRIEERQGISKITHKLYQNVPAEFCSSVCQTGF
HRMYSPPTEQNYGPGIYFKRNPRNLIEDKAMGEMDSKVYVFEAEVLTGLYTKGESNIIMP
LAVKGDAFRIYDSLVNDMANPDTFVIYNSVGALPQYLLTCSPMSKHYAAENSSILSENYS
ELQLF
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgctgctttcgctttcgtttcccgctcgctgcactctgttccccgccccggg
ccctgccccagctccgggcgccgaggggcacacggcagtgccgcaccgagccgctccatg
ggggccatccagggttactttgcaaggacctcggaagagaagatcggtttagggtcaagc
atggtaatggatgaggtcagcttgatgatgcccatcaataaagatgcctatgaagctttt
aagagaagagacagttgtctaagtaatctcatttcccaaaagtttgcttgtgtgttgacc
ttcaaaagcactcttgaagtatacaggaaagaactgaagggaattgacatttgtgtttgt
aagggtgatctcacaagacacaaggttgatgccttggtgaatgcagccaatgaattccta
cagcataaaggaagtcttgccctcgcccttgtggcagctggagggtcagaaatacaagag
gaaagcaacttttttgttcagaagtatggcagactccgagttggcgacatagcagtaaca
ggtgcagggaagcttccttgtaaggcgataattcatgcagttggtccaaagtgggatgct
tctgaaaaggaaaaatgttgtcgcctacttgataaggctattatgaatattctgcattat
gttagtgctccacaaagtgccataaagtctgtggctatcccagcagtgagctcaggtgtc
cttggcttcccacttgagttgtgtgttcaggtgattgtaatggctgtaaggcaatttgtt
gaggtacctccaccaagccttctcagggaaatccgcctggtgaacatcgatgaggctaca
gttgcagaaattaagaaggcctgtgaaaagtttctgaatgataccagttcacttcaggga
actgtgtcatcttcaccaagccagtctttaacttccatcacatgtggaggcattcacttg
cgcatcacaagaggataccttgatgagcaggagactacagctgttgttaaccgcatattt
aaacgtgggaatcctcccagcccattttcaagactgctgcaaaaagctggtccaggtctt
cagaaggaactgaataattgtcttattttttcgacacattataaggaactcatagtaaca
gaagggtatgatctgccttgtgagtttgtactgcacgtggtattgaaagaacacgaactg
ctggtgttgcagtatgaggaattaaagcatgcagtgaaaagatgcctgagccaggatgag
caatgttgctcaatttcttttccagtaaaatggtcattaaagctgcctgttgatatagtg
gcagaggccatgattgaagaggttttaaattttgccagggcacaccccgagaagaagaga
gaagtgcagtttgtcgtttgcccagatgactatattgcctatcaggttttccagagaaaa
ttctattcagcaaaacacagactggagaacagaagtgatccattgagtacagagtcaggc
atccaaagcataaaagacactgcaaatgaagaaaaagtgattgcaattacagggagaaca
cgcacagcagtggaagcagcagaatcatggctgcagagagtggtacaaattcaggaaggt
cgccatgctgttattaaaaacaactacattttttgcctcggtaaaaacgagtttgcagaa
ctctatcaagatatgccttctagtgtatgtgtgtcagaagaagtgagaggtggaaaagca
acactggaatttaaaggccctcctgatgctctgattgatgcagtgctgacaactgagaat
ttgctccttcgtatgcaagagaagactatagctgaacaaaagaaactgctccactcgatg
tgccaaccagaagcaggtcaactttcagaagaagaccttcacaacgcaaatattactaca
tccatcaagattttaccagtagagtcaaacctccaggagtttaaagacagacagaaacag
tttgaaaaagctggacttcatgttctcaagattgaaaagatacataatcctcttctctct
gatgcattccaacaaatgaaaaaaagaatagaagaaagacaaggtatctccaaaataacc
cacaagctgtaccagaacgttcctgctgagttctgtagttcagtttgccagactggattt
cacaggatgtattctccaccaacagaacaaaattatggacctggcatctactttaaaagg
aacccaagaaaccttatcgaggataaagctatgggggaaatggactctaaagtgtacgtg
tttgaggctgaagtattaacaggcttatacactaaaggcgagtctaatattattatgcct
ctggctgtgaagggggatgcctttaggatatatgacagcttggtaaacgatatggccaat
cctgacacctttgtcatttacaacagtgttggggcccttccacaatatctgctgacttgt
tccccgatgtctaagcattatgcagctgaaaacagcagcatcctgagtgagaattactca
gaactgcagctgttttga

DBGET integrated database retrieval system