KEGG   Empidonax traillii (willow flycatcher): 114063103Help
Entry
114063103         CDS       T05887                                 

Gene name
RASSF5
Definition
(RefSeq) ras association domain-containing protein 5 isoform X1
  KO
K08015  Ras association domain-containing protein 5
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    114063103 (RASSF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nore1-SARAH RA 4HB_MCP_1
Motif
Other DBs
NCBI-GeneID: 114063103
NCBI-ProteinID: XP_027750944
Position
Unknown
AA seq 316 aa AA seqDB search
MTGGKAGAAACFGLVTKRIRKLFRHFPKSKPWSEGLRPPRRQSREVLLLRDCRYTCHQEC
RSLIQLDCRRPGPCQSQLSPESTLLPPCSQNVTQTVEEEKPEPPTVQEIKQRIEKYNAKV
TNCLLMKLNDDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDALREVNLADMTDKRTSFYL
PLDAIKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKEMRKDGQVLFQKLPLTEYPL
YLRLLAGPDTDVLSFVLKENETGEVEWDAFSIPELQNFLMILDKEEKDKIQQVHRKYERF
KQRLQQTLKEARGKPG
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcgggaaagcaggagcagccgcttgctttgggctcgtaacaaaaaggattcgc
aagctcttcaggcacttccccaagtccaagccttggtccgaggggctgcggccgcccagg
aggcagagcagggaggtcttgctgctcagagactgcagatacacgtgtcaccaggagtgc
cgcagcctcatccagctggattgccgccggccgggaccgtgccagagccagctgtcccct
gagagcaccctgctgccaccctgcagccagaatgtaacacaaacagtagaagaagaaaag
cccgaacctccgactgtccaggagatcaaacagaggatcgaaaagtacaacgcaaaggtc
accaactgcctgttgatgaagctgaacgacgatgggacgtacacagggttcatcaaagtg
cacttgaagctgcgccggcccgtgacggtgccggccgggatccggccccagtccatctac
gatgccctcagggaggtgaacctggctgacatgacggacaagagaacctccttctacctg
cccctggacgccatcaagcagctccacatcagcagcacgaccacggtgagcgaggtgatc
caggggctcctgaagaagttcatggtggtggataatccccagaagtttgcacttttcaag
gagatgcggaaggacgggcaagtgctcttccagaagctccctctcaccgagtaccccctg
tacctccggctgctggcaggccctgacacagatgtgctgagtttcgtgctgaaggaaaat
gaaacaggggaagttgagtgggatgccttctccatcccagagcttcagaacttcctgatg
atcctggacaaagaagaaaaggacaaaatccagcaagtgcacaggaagtacgagaggttt
aaacagagactgcaacagaccttgaaagaagccagaggcaaacctggataa

DBGET integrated database retrieval system