KEGG   Empidonax traillii (willow flycatcher): 114063201
Entry
114063201         CDS       T05887                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
etl  Empidonax traillii (willow flycatcher)
Brite
KEGG Orthology (KO) [BR:etl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:etl01009]
    114063201 (AKAP5)
Protein phosphatases and associated proteins [BR:etl01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     114063201 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 114063201
NCBI-ProteinID: XP_027751126
Position
Unknown
AA seq 670 aa
MCQDAGIDQENRCYNPDEGGANVVRAAKEAQMENPKEVESPSTGATCSPLEEQAEKPSML
CFKKRKKPCKKGLTVKDACEGASEEKSQCVSTDQGEAKVSSPSQSSKGAWAAIKNLTRPR
RRQKSSSRKKAQSDSQVELEVDAEESCAQDLPKKRASSGVKMPCMRFSRGKKKPRPSEAL
EESEGSVQANEVVGVLNKACEEPEDLAPAEKSESFSPVSAEEDQATVKEDQAAVKEDQAT
VKEDQATVKEDQDTVKEDQATVKEDQDTVKEDQAAVKEDQATVKEDQAAVKEDQDTVKEE
QAAVKEDQTIVKEDHDTVKEDQTTVKEDQAAVKEDQAAVKEDQAVVKEDQASMKEDQAAV
KEDQAIVKEDHDSVKEDQASVKEDQAAVKEKQAIVKEDQAIVKEDQDIAKENDNSVEKSE
PSTEHTPDMEEHTECTVQSEITDSETVNEIAQDKLQEGSLPQTTDDAEGREAPKAPVSKD
QPDSPLETTEQEEIPNICTELPEGDESEKSTNLPEECKAQETVSEFSESTSRDNGASVQE
CSSHQVTSEANAGAGIGVGIVITITEAEDSDNTDSDQAYEPSPVLHQNKQKGNKKSNRNA
DVGKKEGPEAGGGPQAEDKSLGDQGHRTGEQYELLLIETASSLVKAAIQSSIEQLVNEMA
LEQNKHNSFL
NT seq 2013 nt   +upstreamnt  +downstreamnt
atgtgccaggatgcaggcatcgatcaagaaaatcgctgctacaacccagacgaaggagga
gcgaatgtggtgagggcagctaaggaagctcaaatggagaacccaaaggaggtagagtct
cccagcacaggggcaacgtgctccccactggaggaacaagcagagaaaccctccatgctc
tgttttaagaagcggaagaagccctgtaagaaggggctgactgtgaaggatgcgtgcgaa
ggagcctcagaggagaaaagccaatgtgtcagcaccgaccaaggggaggcaaaagtttcc
agtccatcacagtcctccaaaggagcctgggcagccatcaaaaacctcacaaggcctcgg
agaaggcagaaatcctcctcacggaagaaggcacagtccgattcgcaggtggagctggag
gtggatgctgaggagagctgtgcacaagacctcccgaagaaacgggccagctctggcgtg
aagatgccctgcatgcggttctccaggggcaagaagaaacccagaccctcggaagcactg
gaggagtcagagggcagcgttcaagcaaacgaagtggtgggtgttttgaacaaagcctgt
gaagagccagaggatttggccccggcagaaaaatctgaatccttcagcccagtctctgca
gaggaggaccaggctacagtgaaagaggaccaagctgcagtgaaagaggaccaggctaca
gtgaaagaggaccaggctacagtgaaagaggaccaagatacagtgaaagaggaccaggct
acagtgaaagaggaccaagatacagtgaaagaggaccaggctgcagtgaaagaggaccag
gctacagtgaaggaggaccaggctgcagtgaaagaggaccaggacacagtgaaagaggag
caggctgcagtgaaagaggaccagactatagtgaaggaggaccatgatacagtgaaggag
gaccagactactgtgaaagaggaccaggctgcagtgaaggaggaccaggctgcagtgaaa
gaggaccaggctgtagtgaaggaggaccaggctagcatgaaagaggaccaggctgcagtg
aaggaggaccaggctatagtgaaggaggaccatgattcagtgaaggaggaccaggcttca
gtgaaagaggaccaggctgcagtgaaggagaagcaggctatagtgaaggaggaccaggct
atagtgaaggaggaccaggatatagcaaaggaaaatgacaactctgttgagaagagtgag
ccctcgacagagcacacacctgacatggaggaacatacggagtgcactgttcagtcagag
ataactgattcagagacagttaatgaaatagcccaggacaaactccaggaagggagccta
ccccaaaccacagacgatgcagagggcagagaagctcccaaagcacctgtttccaaggat
caacccgacagtccccttgaaaccaccgagcaggaggaaatccctaatatctgcacagag
ctgcctgaaggggatgaatcagagaagagcacaaatcttcctgaggagtgcaaagcccag
gagactgtatcagagttcagtgagtcgacatccagagacaacggagcgagtgtgcaggaa
tgctccagccatcaggtgacatcagaggcaaacgcgggcgccggcattggcgtcggcatc
gtcatcaccatcactgaggctgaggactctgacaacaccgactccgaccaggcctatgag
ccgtccccagttctgcaccaaaataagcaaaaagggaataaaaaatcaaacaggaatgct
gatgttggtaaaaaagagggccctgaggctggtggtggtccccaggcagaggacaaaagt
ctgggtgaccaggggcacagaactggggagcagtacgaattgctcctcatagaaactgcc
tcctccctcgtgaaggcagccatccagtcatccatagagcagctggtcaatgaaatggcc
ctggaacagaataaacacaacagttttctgtga

DBGET integrated database retrieval system