KEGG   Empidonax traillii (willow flycatcher): 114063792Help
Entry
114063792         CDS       T05887                                 

Gene name
FKBP6
Definition
(RefSeq) inactive peptidyl-prolyl cis-trans isomerase FKBP6
  KO
K09572  FK506-binding protein 6 [EC:5.2.1.8]
Organism
etl  Empidonax traillii (willow flycatcher)
Brite
KEGG Orthology (KO) [BR:etl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:etl03110]
    114063792 (FKBP6)
Enzymes [BR:etl01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     114063792 (FKBP6)
Chaperones and folding catalysts [BR:etl03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    114063792 (FKBP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_2 FKBP_C TPR_1 TPR_12 TPR_8 Fis1_TPR_C TPR_19 ANAPC3
Motif
Other DBs
NCBI-GeneID: 114063792
NCBI-ProteinID: XP_027752121
Position
Unknown
AA seq 237 aa AA seqDB search
MKLGKDITLWGLELGLLSMARGEAARFWFSPEYAYGRRGCPPCIPPDTTVLFHVELLDFI
DSEECDLFFELSEVQQDTLPLEKVLKVAATEREFGNYFFHKQNFRVAKHRYKRALSVLGH
SCSSEAEQSQVNISKVPLLLNLSLTYLKLECPKRALKYGEKALEMDQGNVKALFRCGQAC
LCMKEYSKSRDFLTRAQKIQPFNRDINNELKKLERYYEEYVGMQKEMCCRMFASSCG
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttggaaaagacatcacgctgtgggggctggagctggggctgctgtcgatggcg
cggggcgaggcggcgcggttctggttcagccccgagtacgcgtacggccggcggggctgc
cccccctgcatccccccagacaccaccgtgctcttccacgtcgagctgctggacttcatc
gactcggaggagtgtgacctgttcttcgagctgagcgaggtgcagcaggacacgcttcct
ctagagaaggtgttgaaagtggcagccacagagagagagtttggcaactacttcttccat
aagcagaacttcagggttgccaagcacagatacaaaagggctctctccgtcctgggtcac
agctgttccagcgaggccgagcagagccaggtcaacatttccaaggtgcctctgctcctg
aacctctctctcacttacctgaagctggaatgtccgaagagagctttgaaatacggggag
aaggctttggagatggaccagggaaatgtcaaagccctgttcaggtgtggccaggcttgt
ctctgcatgaaggaatacagtaaatcccgggatttcctgaccagagcccagaaaatccag
ccctttaaccgtgatatcaacaacgagctgaagaagctggaaaggtactacgaggagtat
gtggggatgcagaaggaaatgtgctgcaggatgtttgccagctcctgtggctga

DBGET integrated database retrieval system