KEGG   Empidonax traillii (willow flycatcher): 114063965
Entry
114063965         CDS       T05887                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
etl  Empidonax traillii (willow flycatcher)
Brite
KEGG Orthology (KO) [BR:etl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:etl03021]
    114063965 (AFF3)
Transcription machinery [BR:etl03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     114063965 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 114063965
NCBI-ProteinID: XP_027752402
Position
Unknown
AA seq 1184 aa
MKDLLTDRSNQSHLVGVPKSGVPQMTLPKPDEHFIADSRLPPPPPISTTTSSKPASLAAQ
QSKSTTMGWQKTGHNATSDGQQRVSKHGHRSLESHKGDFKLANQKSSLEKLKRYASSPTS
SSSSSSSSSSSSSSCSSSSSSCSSSSSSSSSSNTAQQSSLRATLGDNITRVQQPAKLSCS
SEGGTQAQERPAKHGGGHCVQNFPPSLASKPSLGQQKPTAYVRPMDGQDQAPDESPKMKL
PAETTKSYRGVPSNKPDSARPKSKIAKFSIPKQEEDNGTGDNSCIEEILREMTHSWPPPL
SAIHTPGKAEQSKFPFPNKESQQGSTGHSNTRKTDVEPKSPEKSATHTSMLEDDLKLSSD
EEENDQQAAQRSALRVLSDSLVVSQPNARASGLSSKGSSSSSSSESETSSESDSESESSS
SESDGSKPSHYSSPEPEPPSSNKWQLDKWLNKVTTHKAPILTHHDGPALEAHPYYGRVKA
ERQESEKASAEGPAEHRSGESRTAVAAAGDGPRPRTASKAPGSKGSRQKSPLAADGAPPR
RAAGKKAPRRAERTSAGDGPHCPGAEEPPRSHSFAEGTAGEAPRARPGGTGSGGGCRAGH
RREPRSAAAGEKRRARGPSKTAPKSKEFIETESSSSSSSSDSGSESEREERPLPKAPAAA
GSEPRAKDAGTGTASKPHGGCSAFGSVNARTSSEIAKELEEQFYTLVPFGRNELLSPLKD
SDEVKSLWVNIDLALLSRIPERLPEEPLAMSAEANQAASLPQGSSAEPPAEKGLPKSRRK
RKCENEEECRDIKKTHLDRESSSRLAASAHSITTANHCNMNENSLAIPINKNEKMLRSPI
SPLSDASKHKYSNDDLTSSSRPNGSSLLPSISSSKKHKGEIQSQPHPADFNKAVHINSEN
ILLCNKSQSQTEPWSPLSSTPRDCRRTKLIFDDMPRNADYFMQEAKRKKHKADAMVEKFG
KALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAVRLKTHSGPNATPEDKQ
LAALCYRCLALLYWRMFRLKRDHAVKYSKALIEYFKNSSKAAQNPSPWGASGKSTGTPSP
MSPNPSPVSSVGSQGSTGAPSPSPIISIPQRIHQMAANHVSITNSILHSYDYWELADNLA
KENRDFFNDLDALMGPITLHSSMEHLVQYTQQGLHWVRNSAHLS
NT seq 3555 nt   +upstreamnt  +downstreamnt
atgaaagacttgttaactgaccgatcaaaccagagccatctcgttggggttccaaaatct
ggggttcctcagatgactctccccaagcctgatgaacattttattgcagactcaagactg
ccacctcctcctcccatttccaccactacttcttccaaaccagcatccttagctgcccag
cagagcaaaagtaccacgatgggctggcagaagactgggcataatgccacttcagatggc
cagcagagagtgagcaaacacggacaccggtcgctggagtcacacaagggtgacttcaag
ttggcgaaccaaaaatccagtctggagaaactaaaacgctatgcatcgagtcccacctct
tcctcctcctcctcctcctcctcctcctcctcctcctcctcgtgttcctcctcctcctcc
tcgtgttcctcctcctcctcctcttcctcctcctccaatactgcccagcaaagctcactg
agggccactttaggagacaacatcactagagtgcagcagccagcaaagctcagttgtagc
tcggaaggaggaactcaagcacaagagaggccagcaaagcatggtggtgggcactgcgtc
caaaacttcccaccctctcttgcttcgaagcccagcctgggtcagcagaaaccaacagct
tatgtaaggccaatggatggtcaagaccaggctcctgatgagtctccaaagatgaagtta
ccagcagagacgaccaaatcatacaggggagtgccttccaacaagcctgattcggccagg
cccaagtcaaagatagccaagttcagcattcctaagcaagaagaagacaatggaacagga
gataacagctgcattgaagaaatattacgggagatgacccattcatggcctccaccactg
tcagctattcacacaccaggaaaggcagagcaaagcaagtttcccttcccaaataaggag
tcacaacagggatctacaggacacagcaatacaagaaaaactgatgtagagccaaagagc
ccagagaaaagcgcaacccatacatcaatgctagaagatgacctcaagttaagcagtgat
gaagaagagaatgaccagcaggcagcacagagatctgctctccgcgttctatctgacagc
ctggtggtgtcgcagcccaatgcccgagcctcgggactctccagcaaggggtcgagcagc
agcagctccagtgaatccgagaccagctcagagtctgactcagagagcgaaagcagctcc
agcgagagtgacggcagcaagccctcgcattactccagcccagagcccgagccgccctcg
tccaacaagtggcagctggacaagtggctgaataaagttaccacgcacaaagcacccatc
ctaacccaccacgatggcccggcgctggaagcccatccctactacggccgcgtgaaggcc
gagcggcaggagagcgagaaggcctcggcggagggcccggccgagcaccgcagcggggag
agccgcaccgccgtcgccgccgccggggacgggccgcggcccaggaccgccagcaaagcg
cccggcagcaagggcagccggcagaagtcaccgctcgctgccgacggcgcgcccccaagg
cgggcagcggggaagaaggcaccgcggcgagccgagaggacctccgccggagacggcccc
cactgccccggcgcagaggagcccccccggagccacagcttcgccgaaggcaccgctgga
gaggcgccgagggcccggcccggcggcaccggcagcggcgggggctgcagagcggggcat
cgccgggagccccgctcggctgcggccggtgagaagcgtcgggcccgggggccgagcaaa
acggcgcccaaatccaaggagttcatcgagaccgagtcttcgtcctcttcatcctcctct
gactcgggctctgagtcggagcgggaggagcgcccgctgcccaaggcgccagcggcggcc
gggtccgaaccgcgtgccaaggacgcggggaccggcaccgccagcaaaccccacggcggc
tgcagtgcctttggctcagttaatgccaggactagtagtgaaatagcaaaggagctggag
gaacagttttacaccctggttcctttcggtaggaatgagctcctgtctcctctgaaagac
agtgatgaggtaaagtcgctgtgggtcaacattgacttggctcttttgtccaggattcca
gagcgtttgcccgaagaaccgctggccatgagcgccgaagcaaaccaggcggccagcctc
ccgcagggtagtagtgctgaaccccccgcagagaagggtttaccgaaatctagaaggaaa
cgcaagtgtgagaatgaggaggagtgcagagacatcaagaagacccacttagatcgagag
agttcttcacgattagctgcctctgcccacagcatcacaacagcaaatcactgcaatatg
aatgaaaatagcttggcaataccaataaataaaaatgagaaaatgcttcggtcacccatc
tctcccctctccgatgcatcaaaacacaaatactccaacgatgatttaacttcctccagc
agacctaatggcagcagtctattaccttccatctcctccagcaaaaagcataagggtgaa
atccagtcgcagccacatcccgcagacttcaataaagcagttcacatcaattcagaaaat
attcttctctgcaataagtcgcagtcccaaacagagccttggtcacctctgtccagcaca
cccagggactgcagaaggacaaagcttatctttgatgatatgccacgcaatgcagattac
tttatgcaggaagctaaacggaagaagcataaagcagatgcaatggtggagaagtttgga
aaggcactgaattatgcagaagcagcgctatcgtttattgagtgtggaaatgcaatggaa
caaggcccaatggaatctaaatccccttataccatgtattcagaaacagttgaactcatc
aggtatgcagtgagactaaaaacccactcaggccccaacgccacgccagaagacaaacag
ctggcagcattatgttaccgctgcctggctcttctgtactggaggatgttccgactcaag
agagaccacgcggtcaagtattcgaaagcgcttattgagtatttcaagaattcatcaaaa
gctgcccagaacccatctccttggggtgccagtggaaagagcacaggaactccatcacct
atgtcccccaacccatctccagtcagctctgtaggatcccaggggagcacaggggcccct
tccccatctcctatcatcagcattcctcagcgcattcatcagatggccgccaaccatgtc
agcatcaccaacagcatcctgcacagctatgactactgggagctggctgacaacttggcc
aaggaaaacagagatttttttaacgacttggatgcattgatgggacctatcaccttgcac
agcagtatggagcatttagttcagtacactcagcaaggacttcactgggtgcggaatagt
gctcacttgtcataa

DBGET integrated database retrieval system