KEGG   Empidonax traillii (willow flycatcher): 114064310Help
Entry
114064310         CDS       T05887                                 

Gene name
CACNG3
Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit isoform X1
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04010  MAPK signaling pathway
etl04260  Cardiac muscle contraction
etl04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114064310 (CACNG3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    114064310 (CACNG3)
   04261 Adrenergic signaling in cardiomyocytes
    114064310 (CACNG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:etl04040]
    114064310 (CACNG3)
Ion channels [BR:etl04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   114064310 (CACNG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 114064310
NCBI-ProteinID: XP_027753034
Position
Unknown
AA seq 315 aa AA seqDB search
MRMCDRGVQMLVTTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNDTSRKNEEVMTH
SGLWRTCCLEGTFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSIFPILSVGLLFFGGL
CVAASEFYKSKHNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQSDSKKSYSYGWSFY
FGALSFIIAEMVGVIAVHMYIEKHRQIRARSHSELLKKSAFTRLPPYRYRFRRRSSSRST
EPRSRDMSPISKGFSTIPSTDISMFTLSRDPSKVTMGTLLNSERDHGFLQVHNSIPKEFK
ESLHNNPANRRTTPV
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgtgtgacagaggcgtccagatgctcgtcaccacggtgggagccttcgcagcc
ttcagcctgatgaccatcgccgtgggcaccgactactggctctactcgcgcggcgtgtgt
aggactaagtccacgagcgacaacgacacgagccgcaagaacgaggaggtgatgacccat
tcggggctttggaggacgtgctgcctggaaggaaccttccgaggagtgtgcaagaaaatc
gaccacttccccgaggatgcagactacgagcaagacacggctgagtatctcctgcgtgcg
gtgagagcgtccagcatcttccccatcctcagcgtggggctgctgttcttcgggggcctg
tgcgtggccgccagcgagttctacaagagcaaacacaacgtcatcctcagcgccggcatc
ttcttcgtctctgcaggtctcagcaacatcatcgggatcatcgtctacatctcggccaac
gcgggggacccgggacagagcgactccaagaagagctactcctacggctggtccttctac
ttcggagccctgtccttcatcatcgctgagatggtgggggtgattgccgtgcacatgtac
atcgagaagcaccgccagatccgcgccaggtcccactcggagctgctgaagaagtcagca
ttcacccgcctccccccctacaggtaccgcttccgccggcggtccagctcccgctccacc
gagccccgctcccgggacatgtcacccatcagcaaggggttcagcaccatcccctccacc
gacatctccatgttcaccctctccagggatccctccaaggtcaccatggggacgctgctt
aactcggagcgggaccacggttttttacaggtccataactccatccccaaagagttcaag
gagtctttgcacaacaacccggccaacagacgaaccacgccggtctga

DBGET integrated database retrieval system