KEGG   Empidonax traillii (willow flycatcher): 114064496Help
Entry
114064496         CDS       T05887                                 

Gene name
NKTR
Definition
(RefSeq) NK-tumor recognition protein isoform X1
  KO
K12740  NK-tumor recognition protein
Organism
etl  Empidonax traillii (willow flycatcher)
Brite
KEGG Orthology (KO) [BR:etl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:etl03110]
    114064496 (NKTR)
Chaperones and folding catalysts [BR:etl03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    114064496 (NKTR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase SR-25
Motif
Other DBs
NCBI-GeneID: 114064496
NCBI-ProteinID: XP_027753406
Position
Unknown
AA seq 1474 aa AA seqDB search
MGVQDRPQCFFEIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGIGKTTGKKLCYK
GTTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNG
SQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDTASRPYADVRVIDCGVLVTRS
AKDALEKKKKVCSDSEGSESSSSASSSSESSSDSEAENERNRRRKRKRRTKPKQSRKRRK
EERRKEDPRCKRSSNQRRSLSDKSDLPDRVDVSTKRDKPVVRPEEIPPVPENRFLLRRDV
PVVNVEPEPKLLDATPVLTDQKPSVSKSGRKIKGRGTIRYHTPPRSRSCSESEDDESSET
PPHWKEEMQRLRTYRPPSGEKWSKGDKLSDPCTSRWDERSASRRSRSWSHNGYADLSSVR
YSSHHKKHRKEKKKVKHKKKSKKQKHFKKHKQTKKKKASASSDLESSHSFHRRTKSSCDR
ERKSRSSSISSRRSSRRDWSKSDKEDQSSSSLSSRGSRSYYRSRSRSRSKSRSYSRRSSR
SRSASKSSRSRSRSRSSSNPRQQKTVPSSPRNISTRLNDAKLAKAAEPVRAVLLPSDKVV
VPPVVPESLPVIPLSDSPPPSRWKPGQKPWKPSYERIQEMKAKTTHLIPTQTNYSLVVVK
EANTSSSSYRKRERSSESDRSGYSKGRSDRSSESWPRSRSRSSRSRSYSRSYTRSRSPSS
SRTKSHSSGRSPSPSKYRSDRSGYSESTSYYSLSDEDRHGNRRKSTGSDQKARGPKLRQE
TSSESPLPHKRPKDYDESSQGLKESDTLSSSDFSSDSERSAKAKVTQEKESRFPLGGDAQ
KQGKTSLSSERGEEKPRCERDSDHSKRKAGKEKSLEQPRGGAKTKRKSYSGSKWDSESNS
ERGEARHNRGDSRPSSGKEEGEATSGSDTELSVTKRIKKQSNSSEFLGSDWKTNKQLSSS
ESDSSCSSSADARGKSRKHKHGLKKQLKKSHSKKPKEKSKGKKEKKHKVQKRKEMFHWQP
PLEFGEEEDDEISEKPVAKDDKKEKQPTGDIKDKKQVYEKDEIVPDKMGNGEKSCVSENL
LDKNTTGEASPDRSNLRKESIETNAATGALNSGINVSACKNEMKQAEESNQNGLEDVIQT
DDNMEICTPDRNSPGKVDVDVLSPVILTPKPQALSAAIKKEPQVETPERDAVKVGNNIRD
LINIKEEKETGRQENNSVSGAKDCGLKSEMTENAQSNMIDNKWKPLQGVGNLQPAAVSTA
TEVKSVAVAPEPKPAGLRIEIKAKNKVRPGSLFDEVRKTARLNRRPRNQESSSEEESPGR
DDNSPSRSLSRSRSKSESKSRHRTRSLSYSHSRSRSRSSTYSYRSRSYSRSRSRGWYSRD
RSRSRSSSYHSYKSRSRSYSRSRSRSSSYGHHSRSSRSYTYDSYYSRSRSRSKRSDSYRR
SRSYDRRSRSYGSDSDSDRSYSNNRSPSESSRYS
NT seq 4425 nt NT seq  +upstreamnt  +downstreamnt
atgggggtgcaggaccggccccagtgcttcttcgagatcgagatcaacagggagccagtt
ggtcgaattatgtttcagctcttctcagacatttgtccgaagacttgcaaaaacttcctt
tgcttgtgctcaggtgaaaaaggaattggcaaaacaactggaaagaagctttgctacaaa
ggcaccacattccaccgtgtggttaaaaacttcatgattcaggggggggacttcagcgaa
ggtaatggaaaaggaggtgaatctatttatggtggctatttcaaagatgaaaactttatt
ctcaaacatgacagagcgttccttttgtcaatggcaaaccgagggaaacataccaatggt
tcccaatttttcataacaacaaaacctgctcctcatctcgacggtgtccatgttgtcttt
gggctggttatttctggttttgaagtcatagaacagatagaaaacctcaaaactgacact
gcgagtcgaccctacgcagacgttcgggtcatcgactgcggggtgctcgtcaccagatca
gccaaggatgctttggagaagaagaagaaagtctgttctgactccgaaggctccgagtcc
tcctccagcgcttccagctcttcagaatcctcctctgacagcgaagctgaaaacgagagg
aacaggaggagaaagaggaaaagaagaactaaacccaaacagtccaggaagcgaaggaag
gaggagaggaggaaagaggatccaaggtgcaagcgaagctcaaaccaaagacgcagcctt
tctgacaagagcgacctcccagacagagtggacgtgagcaccaagagggacaagcccgtg
gtacgtcctgaagaaattcccccagtgcctgaaaatagatttttgctcagaagagatgtg
cctgttgtcaatgtagagcctgaaccgaagcttcttgatgccactccagttctgactgac
caaaaaccatcagtctccaaatccggacgaaaaattaaaggaaggggcacaatacgctac
cacaccccccctcgatcccgctcgtgttccgaatccgaggatgacgagagcagcgagacc
cctcctcactggaaagaggagatgcagagattaaggacctaccgacctcccagcggggag
aagtggagcaaaggagataagttgagtgacccgtgtaccagcagatgggatgaaagaagc
gcatcccggagatccaggtcctggtcccacaatggttacgctgacctaagctctgtgagg
tactccagccatcacaagaagcacaggaaagagaagaaaaaggtgaagcataaaaagaag
tctaaaaagcagaagcatttcaagaagcacaagcaaacgaaaaaaaagaaagcctcggcc
tcatcggacctggaatcttctcattccttccacaggaggacaaagtcgtcttgtgatcgt
gagaggaagtctcgttcttcttccatatcttccagacgttcctccagaagggactggtcc
aagtctgataaggaggatcagagctcatcatctttatcgagcagagggtctcgctcttac
tacaggtccaggtccagatccaggtctaaatcgaggtcttactcccgaagaagttctaga
tcgagatcagcctctaaatcgtcgcggtctcgaagtaggtcacggtccagttctaacccc
aggcagcaaaagactgtccccagctctccacggaatatctcaacccgattaaacgacgct
aagttggccaaggcagccgagccggtccgagcagttctgctgcccagcgacaaagttgtc
gtcccaccggttgtcccagaaagcctccctgtgatacccctgagtgacagcccacccccc
tcgaggtggaaacctgggcagaaaccgtggaagccatcctacgagcgaattcaggagatg
aaagctaaaactacccatttaatacccacccaaactaactacagtctggtggtcgttaaa
gaggccaacacctcctcctcctcctaccgcaagcgggagcggagctcggagagcgaccgg
agcggctattccaaaggccgcagtgacaggagctcagagagctggccgaggtccaggagc
aggtcctcccgaagtcggtcctactccagatcctacacacgatccagaagtccatcgagc
tccaggacgaaatcccactcttccggcaggtccccgtcaccgagcaaataccgcagcgac
cgctcgggctacagcgagtccacctcttactattccctcagcgacgaggacagacacggc
aacagacggaaatccacgggcagcgatcagaaagcccggggccccaaactgaggcaggag
acgagctcggagagtcccctgcctcacaaacgccccaaagactacgatgagtcttcccaa
gggttgaaggagagcgacactttgtcgtcctcggacttctccagcgacagcgagcgctcc
gccaaagccaaggtgacccaggagaaggaaagtcgtttcccattggggggggatgctcag
aaacaaggtaaaaccagcctgagttctgagagaggggaggagaagcccaggtgtgagcgg
gattctgatcactccaaaaggaaagcagggaaagagaagtctctggagcaacccagggga
ggggcgaaaacgaaacggaaatcctactcgggcagcaagtgggactcggagtccaactcc
gaaagaggagaggcaaggcacaataggggggattccagaccttcctctggtaaagaagaa
ggagaggccacctcagggtctgatacagagctcagtgtcaccaaaaggataaagaaacag
tccaattcctccgaatttctgggctctgattggaagacaaacaaacagttgtcatcttct
gaatccgacagttcctgttccagctcggcagacgctcgaggcaagtcaagaaaacacaag
catgggttgaaaaagcaacttaaaaagtcgcattccaaaaagccaaaagaaaaatccaaa
gggaagaaggagaaaaaacacaaagtccagaagagaaaagagatgtttcactggcagccc
cccctcgagtttggggaagaagaggacgatgagataagtgaaaagccggttgccaaggat
gataaaaaggaaaagcagcctaccggggacataaaggataaaaaacaagtttatgaaaag
gatgaaatagtcccagataaaatgggaaatggtgaaaagtcatgtgtgagtgaaaacctt
ttagacaaaaacaccacgggtgaggcctccccagatcgcagcaaccttcgtaaagagagc
attgaaacgaacgctgcaaccggtgctttaaactcagggataaatgtttctgcctgcaag
aatgagatgaaacaagctgaggaaagtaaccagaacgggttggaggatgttattcagaca
gatgacaacatggagatctgcactcccgatcgtaactcgccagggaaggtggatgtggac
gttttgtctcctgtcattctcactcctaaaccccaggctttaagtgctgctatcaaaaaa
gagccacaggttgagacccctgagcgagacgctgtcaaagtaggaaacaacattagagac
ttgattaatattaaagaagagaaagaaacgggaaggcaagaaaataactctgtgtctggt
gctaaagactgtggtttaaaaagtgaaatgactgaaaatgcacaaagcaatatgatagac
aataaatggaagcctttgcagggtgttggtaacttgcagccagcagcagtcagtacagcc
acagaggttaagagtgtagcagtagcaccagagcctaaaccagcaggtttaaggattgaa
ataaaagccaagaataaggtgaggcctggatctctgtttgatgaggtcaggaaaactgcc
cggctcaatcggcggcccaggaaccaggaaagctccagtgaggaggaatccccaggcaga
gatgacaacagcccctccaggagcctcagtaggtcacggagtaaatctgagtccaaatcc
agacacagaacaaggtccttgtcctacagtcactccaggagtcgatcccgaagttctaca
tattcgtataggtcaagaagctactcgagaagcaggagcagagggtggtacagcagggat
cgctccaggagtcgaagcagctcttaccacagttacaagagtcgtagtcgtagctacagc
agaagtcgctccagaagtagttcttatggtcatcacagtcgatccagtaggtcctacacg
tatgacagttactacagcaggagccggagcaggagcaaaaggagcgacagctaccgacgg
tctcggagctacgaccgcagatccaggtcctacggctccgacagcgacagcgaccgcagc
tactccaacaacaggagccccagtgaaagcagcaggtacagctga

DBGET integrated database retrieval system