KEGG   Empidonax traillii (willow flycatcher): 114065212
Entry
114065212         CDS       T05887                                 

Definition
(RefSeq) deoxycytidine kinase-like isoform X1
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl00230  Purine metabolism
etl00240  Pyrimidine metabolism
etl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    114065212
   00240 Pyrimidine metabolism
    114065212
Enzymes [BR:etl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     114065212
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 Thymidylate_kin AAA_28
Other DBs
NCBI-GeneID: 114065212
NCBI-ProteinID: XP_027754742
Position
Unknown
AA seq 272 aa
MSTPAKRHCQSPAGSLDSSFQKRLRKISIEGNIAAGKSTFVRLLEKHSDEWEIIPEPIAK
WCNVQTAGDEYQELSTSQKSGGNLLQMLYDKPTRWAYTFQTYACLSRVRAQLKPVSAKLH
EAEHPVQFFERSVYSDRYVFASNLFESGNINETEWSIYQDWHTWLLNQFQSDIELDGMIY
LRTTPQKCMERLQMRGREEEQGIELEYLENLHYKHETWLQERTMRVDFENLKEIPILVLD
VNEDFKNDEIKQEYLIDKVSSKYCFSGSAFLL
NT seq 819 nt   +upstreamnt  +downstreamnt
atgtccacccccgccaagcggcactgccagagtcccgccggctccctcgactccagcttc
cagaaacgcctcaggaagatctccatcgaggggaacatcgctgcagggaagtcaacgttt
gtcaggctgttggagaagcacagtgatgagtgggagatcatccccgagcccatcgccaag
tggtgcaatgtccagacagccggggatgagtatcaggaactttcaacatctcagaagagt
ggaggaaatctgcttcaaatgctgtacgacaaacccacaagatgggcttacacctttcag
acttatgcttgcctgagccgagtaagagcacagttaaaaccggtctcagcaaagctacat
gaagcagaacatccagtgcaattttttgagagatctgtgtacagtgacagatatgtattt
gcttctaacctatttgaatctgggaacatcaatgaaacagagtggtctatttatcaggac
tggcacacatggctcttgaatcagtttcaatcagatattgaactggatggcatgatctac
ctcagaaccacacctcagaaatgcatggaaaggctacagatgaggggaagagaagaggaa
caaggaattgagcttgagtatttggaaaacctccactataaacacgaaacctggctccag
gaaaggactatgagagttgattttgagaacctaaaagagattcctattctggttttggat
gttaatgaagactttaagaatgatgagattaaacaggagtacctgattgataaggtaagt
agcaaatattgtttctctggatctgcttttcttctgtag

DBGET integrated database retrieval system