KEGG   Empidonax traillii (willow flycatcher): 114066665Help
Entry
114066665         CDS       T05887                                 

Gene name
BLVRA
Definition
(RefSeq) biliverdin reductase A isoform X1
  KO
K00214  biliverdin reductase [EC:1.3.1.24]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl00860  Porphyrin and chlorophyll metabolism
etl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    114066665 (BLVRA)
Enzymes [BR:etl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     114066665 (BLVRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biliv-reduc_cat GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 114066665
NCBI-ProteinID: XP_027757299
Position
Unknown
AA seq 327 aa AA seqDB search
MGQEQWCAAPPAPQTCLEASGVFENDSYISKMFGTVVVGVGIAGLARIRDLMNPMPSSPS
EHLKLLGFVSRRSFGNINEAKQISLEDALKSKEIHAAFISTENRSHEETIRMFLEAGKHV
LVEYPMALSAKAAHELWEMAEQKDKVLHVEHIELLTEEYKQLKKEVAGKDLVKGTLHFTG
SVLDENKSGFPAFSGIARLTWLIDLFGDLTVTSATREKQKEKNYSRMTVHFQTANKKPLT
WIEERGPGMRREKKINFCFTSGCLENFPQAPRSSVGLFMQDQNLFAKKLLGQVSKEELAA
EKWRILRCLDLAEVIQQYCEEPEKIYS
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggggcaggagcaatggtgtgctgcgcctcctgcacctcaaacctgcctggaagctagc
ggtgtctttgagaatgatagctacattagcaaaatgtttgggacagtagtggttggagtt
ggaattgctggcttagcacgaatccgagacttgatgaatccgatgccttccagcccttct
gagcacctgaaactccttggattcgtatccaggagaagttttggaaatatcaatgaggcc
aagcagattagcctggaagatgctctgaaaagcaaagagatccatgcagccttcatcagc
acagagaacagaagtcatgaagaaaccatcagaatgtttttagaagctgggaagcatgtc
cttgttgagtaccccatggctttgtctgctaaggcagcccatgagctctgggagatggct
gagcagaaagataaagtgctccatgtggagcacattgaacttcttactgaagagtacaag
cagctgaaaaaagaggtggctgggaaagacctggtgaagggaacgctgcatttcacaggt
agtgtccttgatgaaaacaaatcaggattcccagctttcagtggaattgcccgactgact
tggctgattgacctcttcggagacctcactgtcacctctgccaccagagaaaagcagaag
gaaaagaattattccagaatgactgttcacttccagacagcaaacaagaaacctctgact
tggattgaagaaaggggaccagggatgagacgtgaaaagaaaatcaacttctgtttcaca
agtggttgcctggagaacttccctcaagccccgaggtcttctgtgggccttttcatgcag
gatcagaacctctttgccaaaaaactgctgggccaggtatccaaggaagagctggctgct
gagaaatggagaattttgaggtgccttgaccttgctgaggtgatccaacagtactgtgaa
gagccagagaaaatctattcctga

DBGET integrated database retrieval system