KEGG   Empidonax traillii (willow flycatcher): 114066815Help
Entry
114066815         CDS       T05887                                 

Gene name
HTR4
Definition
(RefSeq) 5-hydroxytryptamine receptor 4 isoform X1
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04020  Calcium signaling pathway
etl04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    114066815 (HTR4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    114066815 (HTR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:etl04030]
    114066815 (HTR4)
G protein-coupled receptors [BR:etl04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    114066815 (HTR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 114066815
NCBI-ProteinID: XP_027757610
Position
Unknown
AA seq 387 aa AA seqDB search
MEELDVNVSSSEGFGIAGKIVLLTFISAVILMAILGNLLVMVAVCRDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAMELVQDNWIYGEMFCLVRTSLDVLLTTASILHLCCISLDRYY
AICCQPLVYRNKMTPLRIAVMLGGCWVIPTFISFLPIMQGWNSIGIIDLIQQRQFNKASN
STYCIFMVNKPYAITCSVVAFYIPFFLMVLAYYRIYITAREHARQIQVLQRAGAPTDGRQ
HPPDQHSTHRMKTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFINYTVPGKLWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCGDERYRRPSILGQTVPCSTTTINGSTHVLRY
TVLRNGHHQEHEKLPIHNDPESQESCF
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggaagaactggatgttaatgtgagttcgagtgagggcttcggcatagcggggaagatc
gtgctgctcaccttcatctccgccgtcattctgatggccatcctggggaacctgctggtg
atggtggccgtgtgccgggacaggcagctcaggaaaattaagaccaattatttcattgtt
tccctggcctttgcggacctgctggtatcggtgctggtgatgccctttggagccatggag
ttggttcaggacaactggatctacggagagatgttctgcctggtccggacgtccctcgat
gtgctgctcaccacggcgtcaatcctgcacctgtgctgtatctcgctggacagatactat
gctatctgctgccagcctctggtgtacaggaacaagatgacccctctgcgcatcgctgta
atgctcggagggtgctgggtaatcccaacgtttatttctttcctccctatcatgcaaggc
tggaatagcattggcatcattgatctgatccagcaaaggcagttcaacaaggcttccaac
tccacctactgcatattcatggtcaacaagccatacgccattacctgctccgtggtggcc
ttctatatccccttcttcctgatggtgctggcctactaccgcatctacatcacggcgcgg
gagcacgcccggcagatccaggtgctgcagcgcgcgggggcccccacggacggccggcag
caccccccagaccagcacagcacccaccgcatgaagactgagaccaaagctgccaagacc
ctgtgcatcatcatggggtgcttctgcctctgctgggcccccttctttgtcacaaacata
gtggaccctttcataaactacacggtgccggggaagctgtggacggctttcctgtggctg
ggctatatcaattcagggctgaaccctttcctctacgccttcctgaacaagtctttcaga
cgtgccttcctcatcatcctgtgctgtggggatgagcgataccgaaggccttccatcctg
gggcagacggttccctgctccaccaccacgatcaatggatcgacgcacgtgctgaggtac
actgttttacgcaatgggcatcatcaggaacatgagaagcttcccatccacaacgaccct
gaatcccaagagtcctgtttctag

DBGET integrated database retrieval system