KEGG   Empidonax traillii (willow flycatcher): 114067331Help
Entry
114067331         CDS       T05887                                 

Gene name
SUCLG1
Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl00020  Citrate cycle (TCA cycle)
etl00640  Propanoate metabolism
etl01100  Metabolic pathways
etl01200  Carbon metabolism
Module
etl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
etl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:etl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    114067331 (SUCLG1)
   00640 Propanoate metabolism
    114067331 (SUCLG1)
Enzymes [BR:etl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     114067331 (SUCLG1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     114067331 (SUCLG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 114067331
NCBI-ProteinID: XP_027758458
Position
Unknown
AA seq 326 aa AA seqDB search
MVCSLFCFFFSLVQQNGVRHCSYTASRKNLYVNKNTKVICQGFTGKQGTFHSQQALDYGT
NLVGGISPGKGGKTHLGLPVFNSVKEAKEQTGASATVIYVPPPFAAAAINEAIDAEMPLV
VCITEGIPQQDMVRVKHKLVRQNKTRLVGPNCPGVINPGECKIGIMPGHIHKKGRIGIVS
RSGTLTYEAVHQTTQVGLGQSFCVGIGGDPFNGTNFIDCLDVFLKDPHTEGIILIGEIGG
NAEEDAAAFLKEHNSGPNAKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKIAALQS
AGVVVSMSPAQLGSTIYKEFEKRKLL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggtttgttctctcttctgtttttttttttctctagttcaacagaatggagtccgacac
tgctcctacacggcatccaggaaaaatctgtatgttaacaaaaacacaaaggttatctgt
cagggttttacaggcaaacagggcacctttcacagccagcaggcgttggactatggcacc
aatctagttggaggaatttctcccgggaaagggggaaaaactcatctaggtctgcctgtg
tttaattctgtgaaggaggccaaagaacaaacgggtgcctctgccactgtgatatatgtc
cctcccccatttgctgctgctgccatcaacgaggcaatcgatgcagagatgcccttggtc
gtgtgcatcactgaagggatcccccagcaggacatggtgcgggtcaaacacaagctggtc
aggcagaacaagacccggctggtgggcccaaactgccctggagtcatcaatcctggagaa
tgtaaaattggtatcatgcctggtcacattcacaagaagggaagaattggtattgtgtca
agatctggaaccttgacatatgaggctgttcatcagacaacgcaagttggattggggcag
tctttctgtgttgggattggaggtgatcccttcaatggaactaattttattgactgcctt
gatgtcttcctgaaggatcctcatactgaggggatcatattgattggggaaattggaggg
aatgctgaagaagatgcagcagcatttttgaaagaacataattctggcccaaatgccaag
ccagtggtgtcgttcatcgccggcctgacggcgcctccgggcaggcggatgggccatgct
ggagcaatcattgctgggggaaaagggggagctaaggagaagattgcagcccttcagagc
gcaggtgttgtggtcagcatgtcccctgctcagctgggcagcaccatctacaaggagttt
gagaagaggaaattgctctaa

DBGET integrated database retrieval system