KEGG   Empidonax traillii (willow flycatcher): 114067902Help
Entry
114067902         CDS       T05887                                 

Definition
(RefSeq) phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma-like
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl00562  Inositol phosphate metabolism
etl01100  Metabolic pathways
etl04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:etl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    114067902
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    114067902
Enzymes [BR:etl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     114067902
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_C2 PI3K_rbd
Motif
Other DBs
NCBI-GeneID: 114067902
NCBI-ProteinID: XP_027759457
Position
Unknown
AA seq 1042 aa AA seqDB search
MAYFGRVPFSHSEFHKGQAGNQVSYPVYPPGSVGEIPLGFDRIVDEVSNEFFFYGSSHSH
HHEEIFSPSHVFGPGVPGQYFYGQPLVAYGEPYPENPVSRWQQGTLSPTVGFRSYLLSDY
RNFSLVDPYPYSQERELCGGSRVNSVTNVFGSAVERGNTSLGFPIGFNSVDARCPIFLDS
RPFGQEERDGSGTGETCLTNTSRRCNIGPAWPHGSGHGREDAGWSIQLVEANQGSNENTV
GFCNAVEKIKHAYPASDLKTNTGRIWSVTTRFPDHILGGTKFRISVWTDFSPSPVLLTQQ
AGCITRDFIVEILRCTNQYPAQEECFLSVYGSDEFLQNDHTLGSHESLHKATPCVQLRLH
STTHLRQSLARTCEDDQRRFCMNQLLRDTCAMRLTRQNLFSVIMNYRGQVEYLLQNEPHK
VDNVIEAAKAICSVLCFVETRDITDAVKKLRALPLVKAQDSLQSVETSMLIEAAVTELSI
AISRLIHVYSSSFDANFQLASIPKSPSCADISLDSQLNFTVYAAHNIPEAWVNSYKVFSF
SCSLTYAGKIICQVKICKTTPVRRSFFFLADWNEKINFPLRIKALPRETMLTIKLLGVNS
ASKNTEVLAWTCSPLYPKERLVHGAVLLSMTLCSTPTAMITPGICSTDTPTSVTLQIDFP
ESNLEFIKPEPEERRGDLEEPTQECLKHIARLSQIHSPLLLSEQQRRILWFYRYHCNNQN
CSLPLVLGSAPSWDRTTVSEMYAVLRSWRFSNPLEALGLLTFSFPDQDIRRTAVQQIENM
SNDELLEYLPQLVQVLKFEWSLESPLVKLLLNRSLQSIQVAHQLYWLLKNAQNEVHFRIW
YKKLLAALQFCAGQTLNNEFSKEEKLIRILEDIATKVKAAGDPKRKEVLEVELSSLQQFF
QEVKACRLPLNPSLVVQGIEADSCSYFTSNAFPLKISFINANTPSGNISVIFKIGDDLRQ
DMLVLQIIRVMDSIWLQEGLDMQMIIYRCLSTGKGQGLVQMVPDATTLAKIHRESGLIGP
LKENTIKKWFHHHHPLESSYQE
NT seq 3126 nt NT seq  +upstreamnt  +downstreamnt
atggcatactttggaagggtgcctttctcacacagtgaattccataaaggacaggctggg
aaccaagtgtcttacccagtgtaccctcctggttctgttggagagatccctctaggattt
gatcgaatagttgatgaagtcagcaatgaattttttttttatggttcatcacattcacat
catcatgaagaaatcttttccccatcacatgtctttggtccgggtgtgcctggccagtat
ttttatggtcagcctctagttgcttatggagaaccttaccctgaaaatcctgtctctcgc
tggcagcaaggcacactgtcacccacggttggattcagatcttatttgctgtctgattac
agaaacttctctctggtggatccctacccctacagtcaagagagggaactctgtgggggg
agtcgtgtaaattcagtcacaaatgtctttggttcagctgtggaaagaggcaacacaagt
ctgggttttcctataggctttaacagcgtagatgcccggtgtcccattttcttagacagc
cgtccatttggacaagaagagagagatggaagtggaactggggaaacttgtttaactaac
acttccagaagatgcaacataggacctgcttggccccatggctctggacatggcagagag
gatgcaggttggtctatccagctggttgaagcaaatcaaggaagtaacgaaaacacagtt
ggtttttgcaacgcagtggagaaaatcaaacatgcctatcctgcttctgacttgaagaca
aataccgggagaatctggagtgtcacaacaagattcccagaccatatccttggtggaaca
aaattcagaatcagtgtttggacagatttttcaccatctcctgtacttcttacacaacaa
gctggctgtatcactcgtgacttcattgtagagatcctccgttgcacaaatcaataccca
gcccaggaggaatgctttctaagtgtttatgggtctgatgaattcttacaaaacgatcac
actttgggcagccacgaaagtcttcacaaggcaaccccctgtgttcagcttcgactacac
agcactactcatctgaggcaaagcttggctcgaacgtgtgaggatgaccaaagaaggttc
tgtatgaatcagctgttaagagacacgtgtgccatgagactgactcggcagaaccttttt
tctgttattatgaactacagaggtcaagtggaatatctgttgcaaaatgagccacataaa
gttgataatgtgattgaagcagctaaagcaatctgcagtgtcctctgctttgtggaaacc
agagacataactgatgcagtcaagaaactccgtgcattgccacttgtgaaagcacaggat
tcacttcaaagtgtggaaacatccatgttaatagaggctgctgtgactgagctctccatt
gccatctctcgtctcatccatgtttacagcagcagctttgatgcaaatttccagcttgcc
agcatacccaaaagcccttcctgtgcagacatcagcctagattcccagctcaacttcact
gtttatgctgcccataacatcccagaagcctgggtgaacagctacaaagttttctctttt
tcctgttcactaacttatgctgggaagataatatgccaagtgaagatttgcaaaactact
ccagttagaagatccttctttttcctggctgactggaacgagaaaatcaactttcctcta
cgaataaaggctcttccgagggaaactatgctgacaataaaactactgggagtaaacagt
gcctctaaaaatacagaagtgcttgcttggacatgctccccattgtatccaaaagagcgg
ctcgttcatggagctgtgctcctcagcatgacgctgtgcagcacacccacagcaatgatt
accccgggcatctgcagcactgacacaccaacctcggtcacactgcagattgactttcca
gaatctaatctggagttcattaaacctgaacctgaagaaagaagaggagatcttgaagaa
ccaacccaagagtgcctgaagcacattgcaaggctttctcagatacattctcccttgcta
ctctcagagcaacagagaagaatcttatggttttatcgttaccactgcaataatcaaaat
tgctcccttcctctggtgctgggcagtgcccccagttgggatcgaacgactgtgtcagaa
atgtatgccgtgttgaggagctggaggttttctaaccctttagaggcacttggacttctg
actttcagttttccggatcaagatattcgcagaacagcagtccaacagatagaaaatatg
tcaaatgatgagttgttagaatacctcccacagctggttcaggtactcaagtttgagtgg
agtcttgaaagccctctagtgaaactcctgctgaatcgttcccttcagagcatccaagta
gcccatcaactttactggctgttgaagaatgcgcagaatgaagttcatttcagaatctgg
tataagaaactactggctgctctccaattctgtgctggacaaaccctgaacaatgagttt
tctaaggaagaaaaactcatcagaattctggaagacattgccacaaaagtgaaagctgcc
ggtgacccaaaaagaaaggaggtgttagaggtggaactcagcagccttcagcagttcttc
caggaggtaaaggcttgccggctccccctgaatccctcacttgttgtccaaggcatagag
gcggattcatgttcatattttacatccaatgcttttccattaaaaatctccttcattaac
gcgaacactccaagtgggaacatcagtgttatttttaagataggtgatgatctacgtcaa
gatatgttggttctgcaaattattcgagtgatggacagcatctggctccaagagggactg
gatatgcaaatgatcatttataggtgtttatctacagggaaaggacaaggattggtacag
atggtgccagatgctactacactagcgaagatccacagggagtctggactgataggacca
ctgaaagaaaacacaattaaaaaatggttccatcatcaccatcctctggaatcaagttac
caagag

DBGET integrated database retrieval system