KEGG   Empidonax traillii (willow flycatcher): 114069126Help
Entry
114069126         CDS       T05887                                 

Definition
(RefSeq) myotubularin-related protein 3-like
  KO
K18082  myotubularin-related protein 3/4 [EC:3.1.3.48 3.1.3.64 3.1.3.95]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl00562  Inositol phosphate metabolism
etl01100  Metabolic pathways
etl04070  Phosphatidylinositol signaling system
etl04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:etl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    114069126
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    114069126
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114069126
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:etl01009]
    114069126
Enzymes [BR:etl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     114069126
    3.1.3.64  phosphatidylinositol-3-phosphatase
     114069126
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     114069126
Protein phosphatases and associated proteins [BR:etl01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    114069126
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related
Motif
Other DBs
NCBI-GeneID: 114069126
NCBI-ProteinID: XP_027761510
Position
Unknown
AA seq 368 aa AA seqDB search
MLPFLGTDFQLCRLKHCCMLCRSAHGCQCEVSGENSWNLLGQERTDLFSRSLILVRQEPR
STGSKDEDFSSYPGPVMDEETQHSLECIQANQIFPRKQLIREDENLQVPFIELHGESTEY
VGRAEDAIIALSNYRLHIKFKESVVNVPLQLIESVECRDIFQLHLTCKDCKVIRCQFSTF
EQCQEWLKRLNNAIRPPAKIEDLFSFAYHAWCMEVYASEKEQHGDLCRPGEHVTSRFKNE
VERMGFDMNNAWRISNINEKYKLCGSYPQEIIVPAWITDKELESVASFRSWKRIPAVVYR
HQSNGAVISRCGQPEVSWWGWRNADDEHLVQSVAKACASDSRSNSNKLMNGNCSRDFSNG
GDLSDVEF
NT seq 1105 nt NT seq  +upstreamnt  +downstreamnt
atgttgccctttcttggcactgatttccagctgtgcaggctgaagcactgctgtatgctc
tgcagatcagctcatggctgccaatgtgaagtatcaggagagaatagttggaaccttctg
ggacaagagagaactgatttattctctcgttctttgattttagtaagacaagagcctcga
agtactgggagtaaagacgaggatttctcctcctatccagggcctgtcatggatgaagag
actcagcacagccttgaatgcatccaggctaatcagatctttcccaggaagcagctgatc
cgagaggatgagaacctgcaggtgccgttcattgaactccacggggagagcacggagtac
gtggggagagcagaggatgccatcattgccctgtccaactacaggctgcacatcaagttc
aaggagtctgttgtgaatgttccactgcagctcatcgagagtgtggagtgccgggatatt
ttccagctccatttgacctgcaaggactgcaaggtgataaggtgtcagttctccacgttt
gagcagtgtcaggagtggctgaaacggctcaacaatgccatccgccccccggccaagatc
gaggacctgttctccttcgcctaccacgcctggtgcatggaggtctacgccagtgagaag
gagcagcacggggacctgtgccggccaggagaacacgtaacttccaggtttaagaacgaa
gtggagcggatggggtttgatatgaacaatgcctggaggatttccaacatcaatgagaag
tacaagctgtgtggcagttacccccaggaaatcatcgttcccgcctggatcacggataag
gagctggagagcgtggcaagcttccgctcctggaagcgcatccctgccgtggtgtacagg
caccagagcaatggggcagtgatctcccgctgtggccagcccgaggtgagctggtggggc
tggaggaacgccgacgacgagcacctcgtccagtctgtggccaaagcctgtgcctcggac
tcgaggtccaacagcaacaaattaatgaatgggaattgttccagagatttctccaacgga
ggggacctctctgatgtggagtttg

DBGET integrated database retrieval system