KEGG   Empidonax traillii (willow flycatcher): 114069298Help
Entry
114069298         CDS       T05887                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl00010  Glycolysis / Gluconeogenesis
etl00562  Inositol phosphate metabolism
etl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    114069298 (MINPP1)
   00562 Inositol phosphate metabolism
    114069298 (MINPP1)
Enzymes [BR:etl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     114069298 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     114069298 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 Harakiri His_Phos_1 DUF4708
Motif
Other DBs
NCBI-GeneID: 114069298
NCBI-ProteinID: XP_027761788
Position
Unknown
AA seq 455 aa AA seqDB search
MAPCGAVCSLLLLPLLVLPPASAGLSGYFGTKSRYEEVNPHLVRDPLSLGPGAGESPPAT
CAPLQLRAVLRHGTRYPTAGQVRRLGELHARLLRRPAEPTACPAAAALAAWPMWYEESLD
GRLAPQGRRDMEQLARRLAARFPALFAARRRLALASSSKHRCLQSGAAFRRGLGPDLSLG
GDEVEVQVNDSLMRFFDHCAKFVALVEENDAAMCQVSAFKEGPEMKKVLEKVASALCLPV
EELNADLVQVAFLTCSYELAIKNVTSPWCSLFTEEDAKVLEYLNDLKQYWKRGYGYDINS
RSSCILFQDIFQHLDKAVEESKSSKPISSPLIVQVGHAETLQPLLALMGFFKDEEPLLAS
NFARQVHRKFRSGRIVPYAANLVFVLYHCDHVNASREEYQVQMLLNERPLSFHHSNETIS
TYADLKDYYRDLLENCHFKEECELPKVNVTAVDEL
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgtgcggggcggtctgctctctcctcctcctgccgctcctcgtcctgccgccg
gcgagcgcgggcttgagcggctacttcggcaccaagtcccgctacgaggaggtgaacccg
cacctggtgcgcgacccgctgtcgttgggtcccggcgcgggcgagtcgccgcccgccacc
tgcgccccgctgcagctccgcgccgtgctccgccacggcacccgctaccccacggccggg
caggtccgccggctgggcgagctgcacgcccggctgctccgccggcccgcggagcccaca
gcctgccccgccgccgccgccctggccgcctggcccatgtggtacgaggagagcctggac
gggcggctggcgccgcagggccggcgggacatggagcagctggcccgccgcctggccgcc
cgcttccccgcgctgttcgccgcccgccgccgcctggcgctggccagcagctccaagcac
cgctgcctgcagagcggggccgcctttcgccgcgggctcgggcccgacctcagtctcggc
ggcgacgaggtggaggtccaagtgaacgattccttaatgcggttttttgatcactgcgcc
aagtttgtagccctggtggaggagaacgacgcggccatgtgccaggtgagcgccttcaaa
gaagggcccgagatgaagaaggtcttggagaaggtggcgagtgccttgtgtttgccagtg
gaggagttaaatgcagatcttgttcaagtggcttttctcacctgctcttacgagttggct
ataaaaaatgtgacctccccatggtgttcactcttcactgaagaagatgccaaggtcctg
gaatacctgaatgacttgaagcagtactggaagagaggatatggctatgacatcaacagt
cgctccagctgcattttattccaagatatcttccagcatttggacaaagcggtggaagag
agcaaaagttcaaaacccatttcttcacctctgattgtccaagttgggcatgcagagaca
ctgcagcccctgcttgccctgatgggtttcttcaaagacgaggagcctctcctggccagc
aatttcgccaggcaagtgcaccgcaagttccgcagcggccggatcgtgccttacgcggcc
aacctggtgttcgtgctctaccactgcgaccacgtgaacgcctccagggaggagtaccag
gtgcagatgctgctgaatgagagacccttgtccttccatcactccaacgagaccatctcc
acgtacgctgacctgaaggactactacagggacctgctggagaactgccacttcaaggag
gagtgtgagctgcccaaagtgaacgtcactgctgtggacgagctgtga

DBGET integrated database retrieval system