KEGG   Empidonax traillii (willow flycatcher): 114069327Help
Entry
114069327         CDS       T05887                                 

Gene name
GALC
Definition
(RefSeq) galactocerebrosidase isoform X1
  KO
K01202  galactosylceramidase [EC:3.2.1.46]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl00600  Sphingolipid metabolism
etl01100  Metabolic pathways
etl04142  Lysosome
Brite
KEGG Orthology (KO) [BR:etl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    114069327 (GALC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    114069327 (GALC)
Enzymes [BR:etl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     114069327 (GALC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_59 Glyco_hydro_59M Laminin_G_3
Motif
Other DBs
NCBI-GeneID: 114069327
NCBI-ProteinID: XP_027761834
Position
Unknown
AA seq 728 aa AA seqDB search
MGFSVEGLRSSLSLRLKMLEEPTAGRRLSCGPVSRAVKSLEFLLTRAPAGVLSLPSCLCA
SCCLWYMVNQSRESSVEWEKWYGEEAAFSCHKPVWSLFLCSLDSLCRELQATSRLLVNYQ
EPYRSQILDYLFKPNFGASLHILKVEIGGDGQSTDGTEPSHMHYENDENYFRGYEWWLMK
EAKKRNPNIKLIGLPWTFPRWIGKGENWPYDYPDVTAYYIVSWILGAKQYHDLDIDYIGI
WNERAFNSKYIKLLRYTLDKRGLEQVRIIASDRLWEPISFVLLIDSELHGVVDVIGAHYP
GTKTVPNAILTGKKLWSSEDYSTFNDEVGAGCWARILNQNYVNGNMTSTIAWNLVASYYE
ELPFGRCGLMTAQEPWSGHYKVEAPIWITAHTTQFTQPGWSYLQVDGHLEGGGSFVALTD
GLGNLTIIIETMTHNHSQCIRPPLPNFSVTPQRATFYLKGSFFMVETLQVWHSRLGFESG
NSSLFQRLHPVKVWRGRFSLDLDVDEVYTLTTLKTGHKCIYPQPPPPHPFPSNYKDDFNI
RNPPFSEAPNFADQTGVFEYFINASDPGDHVFTLRQVVVQRPITWVSDADQTISIIGNFQ
WVNLTVTCDIYIEKQHDGGVFIAGRVDNGGIYVRRTKGVFFWVFADGTYRVTRDLAGEEI
LMKGLSGVRDNAWHTLTLNIQGNSASGLLNGYPLWENVTVSKPRHGWAALGTRSFEFAQF
DNFHVEAS
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgggcttttctgtagagggtcttcgtagctccttgtctctgcgtctgaaaatgctggaa
gagccaacagccggtcgtcgtctttcctgtggtccagtcagcagagccgtgaaatccctg
gagtttttacttactcgtgcacctgctggggtgctttccttgccctcctgcctgtgtgcc
tcctgttgcctttggtatatggtgaaccaaagcagggagagttcggtagagtgggagaaa
tggtacggggaggaagctgcgttttcgtgccataagcctgtgtggtctctgtttctctgt
tctctggactctctttgcagggaattgcaggccacatctagactcctggtgaactaccaa
gaaccttaccgctcccagattttagattacctgttcaagcctaattttggtgcttcttta
catattctcaaagtagagattggcggtgatgggcagtcaacagatggtactgaaccctcc
catatgcactatgaaaatgatgagaactacttccggggctatgaatggtggctgatgaaa
gaagctaaaaaaaggaaccccaacattaaactgattggattaccttggacatttccaaga
tggatagggaagggtgaaaactggccctatgactatccagatgtcactgcttactatatt
gtttcttggatattaggagcaaaacagtatcacgatttggacattgattatatagggata
tggaatgaaagggcatttaatagcaaatacattaagctgttgaggtacacattggataag
cgtgggctggagcaggtgaggatcatagccagcgatagactgtgggagcccatttccttt
gtcttgctgattgactctgagctccatggagtggtcgatgtgattggagctcactatcct
gggacaaaaacagtgccaaatgccatattaactgggaagaaactatggtcttcagaagat
tacagtactttcaatgatgaagtaggtgcaggctgctgggctcggattctgaaccaaaac
tacgtgaatggaaacatgacctcgacaattgcatggaacttggtggctagttattatgaa
gagttgccttttggtcgatgtgggttaatgacagcacaagagccatggagtggccattat
aaagttgaagctcctatttggattacagcacacacaacacaatttactcagccaggctgg
tcatacttgcaagtggatggacacttagaaggaggtggcagttttgtagctctgacagat
ggtctaggaaaccttaccatcatcattgaaactatgactcataatcactctcagtgtatc
aggcctccactgcctaatttcagtgtcacacctcagagagcaactttctacctcaaaggg
tcattttttatggtggaaactcttcaagtgtggcattctagacttggttttgaatctgga
aactccagtctttttcagcgactccaccctgtaaaagtgtggaggggaagattttcttta
gatctagatgtggatgaagtctacactttaaccacactcaagacaggacataaatgcatt
tacccacagccgcctccacctcatccttttccttcaaattacaaggatgattttaatata
cgtaatccacctttcagtgaagccccaaattttgcagatcagacaggtgtctttgaatac
tttataaatgcttctgacccaggagatcatgtgttcacactccgccaggtggtggttcag
cggcccatcacttgggtttctgatgcagaccagaccatcagtatcataggaaattttcag
tgggtgaacctgacagtcacctgtgacatctacatagaaaagcagcatgatgggggcgta
tttattgcaggaagagttgacaatggtgggatatacgttcgacgtaccaagggagttttc
ttctgggtttttgcagatggcacctacagagtgactcgtgacctagctggagaagaaata
ttaatgaaaggactttctggtgtccgggataatgcatggcacacacttactctcaacatt
cagggcaattctgcctcaggactgttaaacggttatccgctctgggagaatgtcaccgtt
tctaaaccaaggcatggctgggctgctcttggaactcgctcgtttgagtttgcacagttt
gacaactttcacgttgaagccagctga

DBGET integrated database retrieval system