KEGG   Empidonax traillii (willow flycatcher): 114070102Help
Entry
114070102         CDS       T05887                                 

Gene name
ESPL1
Definition
(RefSeq) separin
  KO
K02365  separase [EC:3.4.22.49]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04110  Cell cycle
etl04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114070102 (ESPL1)
   04114 Oocyte meiosis
    114070102 (ESPL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:etl01002]
    114070102 (ESPL1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:etl03036]
    114070102 (ESPL1)
Enzymes [BR:etl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     114070102 (ESPL1)
Peptidases [BR:etl01002]
 Cysteine Peptidases
  Family C50: separase family
   114070102 (ESPL1)
Chromosome and associated proteins [BR:etl03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Separase
    114070102 (ESPL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT TPR_12
Motif
Other DBs
NCBI-GeneID: 114070102
NCBI-ProteinID: XP_027763112
Position
Unknown
AA seq 2023 aa AA seqDB search
MDGKEERDGIEERLKKLRDSLRIPPGVPPPSRQQRLQTCDRVLRSCVEQLGREGPPSLGP
PLVALAQEAARGYLSMVPNPPGLYMEKILFHLLKNAVNSCQSTGNSCWAAAELLWERLRT
YAPLQDPPKDFTTVTYNAFCVLWKGAAALAGPDRPREEGRSLFSAQIRALRFLLLLERDR
GSLPSLQPPFFTSQTAQKAAAASALYEAERAPCPVFLARQLREFLLETLCNEASNPPSIQ
HSLCFLELTLERSRHLCRAGRFHEALEALEEAKAFLGHSREDLRAPLVLLEAGIQLGKGR
FPPGPLLCQAAAALRGEGSERTLGVLLEGARFVTSQLGEVTRRSRELPFSLEDLPGLCAF
TEGHCRALQRLLGRVPPDALKQQVTVKQLLFRSLQLFSNTVHDTFQGSQPSGWLGLAQVS
RSCTQSVTWMVEALEGLPETDRTKFLDVTASCTFKLGFAFQSQNFLEEAGTICEPFCRGV
GELGGYGCPDTSPERLHKCFRVQVESWKRLGWLERALGSVTTWLLALAWPGRPLAQAGGV
LGTEPGGLLHEPVGLWAKIKLEAAKQGQKELRLRTLKDSLEGHSLDKATLVSFLLAELQA
YKCLKWDTGPERYNVLCDLLELCPEDPGGLLPRALGLLELAQVLCYHSFAPHTNCSALDA
IQEALRLLEKVQRNSQNRDQLLDEKAQALLWLHICTLEAHMEKGMEREQRGRTQGSKNLE
DFEPNDLNAEGRAGEEPDPWDGISCTLDTDRALTKSLDEAFSLWKQLLESPGIPRVRSLE
QTVTSLHLLATLYKLLAKPIQALESFLLLQSLCRSLGDIPGTAWALSHLTRLLLQLECPT
HAQVFLEELESILREFPRGDESQQLLQHSCLLLRSHLCCVSQNVEEGLSLLLQVVQSPLA
QKATKGWYLLQAQGLQVVAMYLGMAPAHLGPELRHRLHQKGWKTPKVALMEVQKLLRSVI
IFLLGFDILGGSRNNEGGEQFQDYGANVVLKWEVLGEALWCCERLVMLLGWAEVLCRARA
FCGEALRVSRLLQGTRWCTSFLLLKSQLELQQGELELSQLNLQHTLFLLQPHPEPKPPQE
PLLPPKIHLRKGHMEPRRRWDHPKNAPGEDDEGFLKGPALEFVAPSNSQDPLGALTASPE
LKPMRKINLAFLSHPWSCPCCRCSDLVVSVLGLRWALAQSRGQVLAGEGAAGVALVRRVL
PRCARVGQRFARELGDRLGGHHGEGEPPRDRNHPRNQDIPGNGDPPGTGDPTRHGHPLGY
WDLGLQDPHEDQDPAENWDLPTLEPQNPPKTRPQPTLGLLDELVAMGYCTLALQSLSSPG
GLWDPQDKELEWGLAFLGSCSPHLPGLGVSRATLLLAKATATLGYMATKLGDVQRKKEQE
TPQKGALEEKTKQGPPSQGVLGGLNPLRAVEEEEEEELRHSFEALQVSQEWEGPPGRVQP
KGEVKAGVDVLGRGDLLPGFGGPLPMAGGPPSLDSVLGLLQEALGWISHFPPGSLYGGLC
QLLALLMGDRDPLGTAGLLSESLCVTARHQLLSILHSRARKKRKKEKLAGDVSEQLQGLS
LQEGGDPPQPCPRLAQLEELFQFSSSGLGAPEREQFQEQIQQIPSGVTVVLLALGSPCPG
ALGDTLLLTRLERDMEPLIIRIPTHRSQAPLSSILREFELIQCEQKEANGCTDKQEWWSR
RSRLDQRMKTLIQSLESHVLGCWRGLLLPRSPRSSPSLAEESSRLIPELRSCGWNEPNPT
LVQVLLNGAPALTPPDVQALAFGLCPARPLRARLILEEALEGALERGQGDRVGSLVLLLD
KHLQRLPWESLPALGAVPVTRLPALRFLLSYVMAQQSSGSVLARGVNPKSTFYVLNPHNN
LGGTEQRFRAWFESEPGWHGVSGSIPTPEQIQEALLEHDLYIYAGHGSGVRLLDRQTLSR
LECRAVVLLFGCSSAAMALKGGLEPTGTVLRYIMAGCPLVLGTLWDVTDRDLDRFAQALL
QGWLRGGPGTPLLPHLAQARQAPRLKSLIGAAPVAYGLPVSLS
NT seq 6072 nt NT seq  +upstreamnt  +downstreamnt
atggacgggaaggaggagcgggacggcatcgaggagagactgaagaagctgagggattcc
ctgcgaatcccgccaggagtgcccccaccatcccgtcaacagcggctccagacgtgtgac
cgcgtgctccgatcctgtgtggaacagctgggccgggagggtcccccctcccttggcccc
ccccttgtggccctggcccaggaggctgccaggggctacctcagcatggtcccgaacccc
ccaggcttgtatatggagaagatcctctttcacctgctcaagaacgctgtgaattcctgc
cagagcaccgggaattcctgctgggctgcggcagagctgctgtgggagcggctccgaacc
tacgcccccctccaggacccccccaaggacttcaccaccgtcacctacaacgccttttgt
gtcctctggaaaggggcagcggccctggcagggcctgaccggcctcgggaagagggaaga
tccctgttttctgcccagatccgtgccctgcgcttcctgcttctgctggagcgggacagg
gggtctctgccctccctgcagccccccttcttcacctcccagacggcccaaaaggcagca
gcagcctctgccctctatgaggccgagagggctccctgccctgtgttcttggctcggcag
ctccgggaattcctcctggagactctctgtaatgaagcctcaaatcctcccagcatccaa
cactccctgtgcttcttggagctcaccctggagcgctctaggcacctctgcagggctggc
aggttccacgaggccctggaggccctggaggaggccaaggcattcctggggcactccagg
gaggatttgagggcccccctggtgctgctggaggccgggatccagctgggaaaggggagg
ttccccccagggcccctgctgtgccaggcagctgcagcactgaggggggagggctcggag
aggacccttggggtgctgctggagggggcccggtttgtgacgtcccagcttggggaggtg
acgaggaggagtcgggagctgcccttcagcctcgaggacctacctgggctctgtgccttc
accgaggggcattgccgggccctgcagcggctgctgggcagggtgccccccgatgccctc
aagcagcaggtgacggtgaagcagctcctgttccggagcctccagctcttctccaacacc
gtccacgacaccttccagggctcccagccctcagggtggctggggctggcccaggtgagc
aggagctgcacccagagcgtgacctggatggtggaggctctggaggggctccccgagacc
gacaggaccaagttcctcgatgtcacagcctcgtgtaccttcaagctgggcttcgccttt
cagagccagaactttctggaagaggccggaaccatctgcgagcccttctgcaggggggtg
ggggaactggggggctacggctgccctgacacttccccagagaggctccacaagtgtttc
cgggtgcaggtggagagctggaagcgcctggggtggctggaacgggctctgggctcagtg
accacgtggctcctggccctggcatggcctgggagacccctggctcaggctgggggggtc
ctggggaccgagcccggggggctcctgcatgagcccgtgggactctgggccaagatcaag
ttggaggcggccaaacagggacagaaggagctgcggctgcggaccctcaaggactccctg
gaaggccattccctggacaaggccaccctggtgtccttcctgctggctgagctccaggcc
tataagtgcctgaagtgggacacggggccagagcgttacaacgtcctgtgtgacctcctg
gagctctgccccgaggaccccggggggctccttcctagagctctggggctcctggagctg
gcccaggtcctgtgctaccacagcttcgccccccacaccaactgctccgctctggacgcg
atccaggaggccctgaggctgctggaaaaggtgcagcggaattcccagaaccgggatcag
ctcctggatgagaaggcccaggccctgctctggctccacatctgcaccctcgaggcccac
atggaaaagggcatggagagggagcagagggggaggacccagggcagcaagaacctggag
gactttgagcccaatgacctgaatgccgagggaagggcgggagaggagccggatccgtgg
gatgggatcagctgcaccctggacactgacagagctcttaccaaaagcctggatgaagcc
ttttccttgtggaagcagctcctggaatcccctggaattccccgtgttcggagcctggaa
caaaccgtgacctccctgcacctcctggccaccctctacaagctcctggccaagcccatt
caagccctggagagtttcctgctgctccaatccttgtgccggagcctcggcgacattcct
ggcactgcctgggccttgtctcacctcacccggctcctcctgcagctggaatgtcccacc
catgcccaggttttcctggaagagctggagtccatcctgagggaattcccacgtggagat
gaatcccagcagctcctgcaacattcctgcctcctgctccggagccacctgtgctgtgtc
agccaaaacgtggaggaggggctgtccctgctcctgcaggttgtccagagccccctggcc
caaaaggccaccaagggctggtacctactccaggcccaggggctccaggtggtggccatg
tacctgggaatggctcctgcacacttgggtccagagctccgacaccggctccaccagaaa
ggctggaagacgcccaaagtggccctgatggaggtccagaagctccttcgcagtgtcatc
attttcctcctgggctttgacatcctggggggctcccggaacaacgaggggggagagcag
ttccaggactatggtgccaacgtggtgctgaagtgggaggtgctgggggaggccctgtgg
tgctgtgagcgcctggtgatgctgctgggctgggccgaggtgctgtgccgggccagggcc
ttctgcggagaggccctcagggtgtcgaggctgctgcagggcacacggtggtgcacgtca
ttccttctgctgaaatcccagctggagctgcagcagggggagctggagctgagccagctc
aacctccagcacaccctgttcctgctgcagccccacccagagcccaaacctccccaggaa
ccactgctcccacccaagatccacctgaggaagggccacatggagccaaggaggcgctgg
gaccaccccaaaaatgccccaggagaggacgatgaggggttcctgaagggccctgccctg
gaattcgtcgccccttcgaactcccaggaccctctgggtgccctcacagcctcccccgag
ctgaaacccatgaggaagattaacctggccttcctctcccacccctggagctgcccctgt
tgccgctgctcagacctggtggtgtcggtgctgggcctgcgctgggccctggcccagtct
cggggccaggtccttgcaggggagggggccgcgggggtagccctggtgaggagggtccta
ccccgctgtgccagggtgggccaaaggtttgccagggagctgggggataggctggggggg
caccatggagaaggggagccccccagggacaggaaccaccccaggaaccaggatatccct
gggaatggggaccctcctgggactggggaccctaccaggcacgggcacccacttgggtac
tgggacctggggctgcaggacccccatgaggaccaagaccctgctgagaactgggatctg
cccaccctggagccccagaacccccccaaaacaagaccccagcccaccctgggcctgctg
gatgagctggtggccatgggctactgcaccttggccctgcagagcctgagcagccccggg
gggctctgggacccccaggacaaggagctggagtggggattggccttcctggggtcctgc
agcccccacctgcctggcctgggggtctccagagccaccctcctgctggccaaggccacg
gccacccttggctacatggccaccaaactgggtgatgttcagaggaagaaggagcaggag
accccccaaaaaggggctctggaggagaaaacaaagcagggacctccctcccagggggtg
ctgggggggctgaaccccctgagggccgtggaggaagaggaggaggaagagctacggcac
agctttgaagccctgcaggtctcccaggagtgggagggacccccagggagggtccagccc
aagggggaggtcaaggccggtgtggatgtcctaggcaggggggacctcctgccaggtttt
gggggacctctgcccatggctggaggtcccccatccctggactcagtcctggggctgctg
caggaggccctgggctggatcagccacttccctccggggtccctgtacggggggctgtgt
cagctgctggctctgctcatgggggacagggaccccctgggcacagcggggctgctctcg
gaatccctgtgtgtcaccgcccgccaccagctgctgagcatcctgcacagccgggcaagg
aagaagaggaagaaagagaagttggcgggggacgtgtcagagcagcttcagggcctttcc
ctgcaggaagggggggaccccccccagccctgcccccgcctggcccagctcgaggagctc
ttccagttcagctcctcggggctgggggctccagagagggaacaattccaggagcagatc
cagcagatccccagtggggtgaccgtggtcctgctggccctgggcagcccctgcccgggg
gcccttggggacactctgctcctgacccggctggagagggacatggagcccctgatcatc
cggatccccacccacaggtcccaggcccccctcagttcgatcctgagggaatttgagttg
atccagtgtgagcagaaggaagccaatggatgcacagacaaacaggagtggtggtcacgg
cgttcccggctggatcagaggatgaagaccctcatccagagcctggagtcccatgttttg
gggtgttggcgggggctgctcctgcccaggtcccccagaagctcccccagcttggcagag
gaatcctcccggctcatcccagagctgcggagctgtggctggaatgagcctaaccccacc
ctcgtccaggtgctgctgaacggggcccctgcactgaccccccccgatgtccaggccttg
gcctttggcctctgcccggcccggcccctccgggcacggctgattctggaggaggccctg
gaaggggccctggagaggggccagggggacagggtggggtccctggtgctgctgctggac
aagcacctgcagcgtctcccctgggagtccctcccggccctcggggccgtgccggtgacg
cgcctcccggccttgcggtttctactcagctatgtgatggcccagcagagctcagggtct
gtcctggcccgaggggtgaaccccaaaagcaccttctatgtcctaaacccccataacaac
ctggggggcaccgagcaacgcttccgggcctggtttgagagtgagcccggctggcacggt
gtatctggctctatcccgaccccagagcagatccaggaggcccttctggagcatgacttg
tacatctatgcggggcacggatcgggggtgcggctcctggacagacagaccctttcccgg
ctggaatgtcgggccgtggtgctgctcttcggctgctccagtgccgccatggccctgaag
gggggcctggagcccactgggaccgtgctcagatacatcatggctgggtgccccctggtg
ctggggacattgtgggacgtcactgaccgggacctggaccgctttgcccaggcactgctg
cagggttggctgaggggggggcctgggactcctcttctgccccacctggcccaggcccgc
caggctccccgactcaaatccctcatcggggctgcgcctgtggcctacgggctccccgtg
agcctcagctga

DBGET integrated database retrieval system