KEGG   Empidonax traillii (willow flycatcher): 114071380Help
Entry
114071380         CDS       T05887                                 

Definition
(RefSeq) activin receptor type-1-like isoform X1
  KO
K04675  activin receptor type-1 [EC:2.7.11.30]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04060  Cytokine-cytokine receptor interaction
etl04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    114071380
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114071380
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etl01001]
    114071380
Enzymes [BR:etl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     114071380
Protein kinases [BR:etl01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   114071380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta_GS Pkinase_Tyr FTA2 TMEM154
Motif
Other DBs
NCBI-GeneID: 114071380
NCBI-ProteinID: XP_027765008
Position
Unknown
AA seq 277 aa AA seqDB search
MILPVLMVMAFPSPSWQDDELKLKMVHYECVCEGMSCGNGDRCQGQQCFASLSINDGAKV
YQKGCFQVYEQGKMTCKTPPSPDQAVECCQGHLCNMNITAQLPSSKGQTFQGEAAGYSME
TLIIVILAPVIVLIVFSAVAVLIIRRIQKNHMERLNSRDAEYGTIEGLIASNVGDSTLAD
LLDHSCTSGSGSGLPFLVQRTVARQITLVECVGKGRYGEVWRGQWQGENVAVKIFSSRDE
KSWFRETELYNTVLLRHENILGKWDNHVLCPGVAGVR
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgattctccctgtgctgatggtgatggcgttcccgtccccgagctggcaagatgatgaa
ctgaagctcaagatggtgcactacgaatgtgtgtgtgaaggcatgtcctgtgggaacggg
gaccggtgccaaggccagcagtgctttgcttccctgagcatcaatgacggggctaaggtt
taccagaagggctgcttccaggtctatgagcaggggaaaatgacctgcaaaacacctcca
tcccccgaccaggctgtggagtgctgccagggacacctgtgcaacatgaacatcactgca
cagctgccctcttcgaaagggcaaacctttcaaggagaagctgcaggctacagtatggag
acactaatcatcgttatcctggctcctgtgatagtgttgatagttttttctgcagtagca
gtgctgatcatccggagaatacagaaaaaccacatggagaggctcaattctagggatgca
gagtatggcaccatcgagggtctcatcgcctcgaacgtgggggacagcacgttggcagat
ttgttggaccattcctgcacatctggaagtggttctggacttcctttcttggtgcaaaga
acggtggctcgacagatcacgcttgtggagtgtgtaggaaagggccgttatggagaagtc
tggaggggtcagtggcaaggagaaaacgttgctgtgaagatcttctcttctagggatgaa
aagtcctggttcagggaaactgagctgtacaacactgtgttgctgcggcacgagaatatt
ttgggtaagtgggacaaccacgtcctgtgtcctggtgtggctggtgtaaggtga

DBGET integrated database retrieval system