KEGG   Empidonax traillii (willow flycatcher): 114072324Help
Entry
114072324         CDS       T05887                                 

Definition
(RefSeq) glutathione S-transferase 2-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl00480  Glutathione metabolism
etl00980  Metabolism of xenobiotics by cytochrome P450
etl00982  Drug metabolism - cytochrome P450
etl00983  Drug metabolism - other enzymes
etl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    114072324
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    114072324
   00982 Drug metabolism - cytochrome P450
    114072324
   00983 Drug metabolism - other enzymes
    114072324
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etl02000]
    114072324
Enzymes [BR:etl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     114072324
Transporters [BR:etl02000]
 Other transporters
  Pores ion channels [TC:1]
   114072324
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: A_deaminase GST_N GST_C_3 GST_C GST_C_2 GST_C_6 GST_N_3
Motif
Other DBs
NCBI-GeneID: 114072324
NCBI-ProteinID: XP_027766036
Position
Unknown
AA seq 359 aa AA seqDB search
MLENIFLPLYEATVHPAQHPELHLFLEHVDGFDSVDDESKPEHHIFNLDSPLPGNWVEED
NPPYSYYLYYMYANMTVLNHLRRKRGFHTFVLRPHCGEAGPIHHLVSGFMVSENISHGLL
LRKVSGEGALGGHTHAGDPRNAQGPGVCPPQLAHAIRLLLEYTETPYQERQYRSGPAPDF
DQSDWTNEKEKLGLDFPNLPYLIDGPVKLTQSNAILRYIARKHNMCGETEEEKQRVDVLE
NQLMDFRMGFIRLCYNPDFEKLKAGYLEQLPKKLQEFSRYLGSRTWFAGDKLTFVDFLAY
DMLDQHRMFVPNSPEFQGNLGKFLQRFEALPKISSYMKTPRFMKTPIFWRTAKWSNTKE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgctggagaacatcttcctgcccctctacgaggccaccgtgcacccagcccagcacccc
gagctgcacctcttcctggagcacgtggatgggtttgacagcgtggatgacgagtccaag
ccggagcatcacatcttcaacctggacagccccctgcccgggaactgggtggaggaggac
aacccgccctactcctactacctgtactacatgtacgccaacatgaccgtgctcaaccac
ctgcgcaggaagaggggcttccacacgttcgtgctgcggccgcactgcggcgaggccggg
cccatccaccacctggtgtcggggttcatggtgtccgagaacatctcccacgggctcctg
ctgcgcaaggtgagcggggagggggcgctgggggggcacacacacgcaggggacccccgg
aatgcccaagggcctggagtgtgtcccccccagctggcccacgccatccgcctgctgctg
gagtacacggagaccccctaccaggagcgccagtaccgctctggcccagcccccgatttt
gaccagagcgactggaccaacgagaaggagaaactggggctcgacttccccaatctcccg
tatctcatcgatggccccgtcaagctgacccagagcaacgcgatcctgcgctacatcgcc
cgcaagcacaacatgtgcggcgagacggaggaggagaagcagcgcgtggatgtgctggaa
aaccagctcatggatttcaggatgggcttcatccggctctgctacaaccccgacttcgag
aagctgaaggcgggatacctggagcagcttcccaagaagctccaggagttctcgcgctac
ctgggctcccgcacctggttcgcgggggacaagctgaccttcgtggacttcctggcatac
gacatgctggaccagcaccgcatgttcgtgcccaacagccccgaattccagggaaacctg
ggcaagttcctgcagcgcttcgaggccctgcccaagatctcctcctacatgaagacccca
cgcttcatgaaaacacccattttctggcgcacggccaagtggagcaacaccaaggagtga

DBGET integrated database retrieval system