KEGG   Edwardsiella tarda EIB202: ETAE_0130Help
Entry
ETAE_0130         CDS       T01121                                 

Gene name
pldA
Definition
(GenBank) outer membrane phospholipase A
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
etr  Edwardsiella tarda EIB202
Pathway
etr00564  Glycerophospholipid metabolism
etr00565  Ether lipid metabolism
etr00592  alpha-Linolenic acid metabolism
etr01100  Metabolic pathways
etr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ETAE_0130 (pldA)
   00565 Ether lipid metabolism
    ETAE_0130 (pldA)
   00590 Arachidonic acid metabolism
    ETAE_0130 (pldA)
   00591 Linoleic acid metabolism
    ETAE_0130 (pldA)
   00592 alpha-Linolenic acid metabolism
    ETAE_0130 (pldA)
Enzymes [BR:etr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     ETAE_0130 (pldA)
    3.1.1.32  phospholipase A1
     ETAE_0130 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: ACY82977
UniProt: D0Z9A3
Position
131036..131923
Genome map
AA seq 295 aa AA seqDB search
MNACKKYLMAGVAALPLVAQAAPSASESGAAPALSDNEGVIANMLRHYDNPFTLYPYSTN
YVLYTQTSDINKEAISSYDWGDQAKKNEIKFQISLAFPIWRGIAGDNSVLGAAYTQQSWW
QAFNRSESSPFRETNYEPRLFLGWATDYPLFGGWVLRDIEAGGVHQSNGRSDPTSRSWNR
VYTRFLAQNGNFQVQLMPWYRIPESPNKDDNPDITKYMGYYEAEMGYRLGESVFSLRGRY
NWNSGYGAAELGWSYPLTRHVRFYTQLFSGYGESLIDYNFRQTRFGVGVMLNDIL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgtgtaaaaaatatttaatggccggagtggcggcgttgccactggtggcgcag
gcggcgccgagtgcgagtgaaagcggtgcggctcccgcgctgagtgataatgagggggtg
atcgccaacatgctgcggcattacgataacccgtttacgctctatccttactccaccaac
tatgtgctgtatacccagaccagcgatatcaataaagaggccatcagctcttacgactgg
ggcgatcaggctaaaaagaacgagattaagtttcagattagcctggcattccccatctgg
cgcggtatcgccggcgataactcggtgctcggcgcagcctacactcagcagtcctggtgg
caggcctttaaccgcagcgaatcttctccgtttcgcgaaaccaactatgagccgcgcctg
tttttaggctgggcgaccgactatcccttgttcggcggctgggtgctgcgcgatattgag
gcgggcggagtgcaccagtctaatggccggtcggatccgacctcgcgcagctggaaccgc
gtctatacccgttttctggcgcagaacgggaattttcaggttcagctgatgccgtggtat
cgcattccggagagtccgaacaaggacgataaccccgatatcaccaagtacatgggctac
tacgaagcggagatgggctatcgcctgggcgagagcgtcttcagcctacgtgggcgctac
aactggaacagcggctatggcgcggccgagctgggctggagctatccgctgacccgccac
gtccgtttctatacccagctgttcagcggctacggcgagtcgttaatcgactataacttc
cgccagacccgcttcggcgtcggcgtcatgctgaacgatatcctgtaa

DBGET integrated database retrieval system