KEGG   Edwardsiella tarda EIB202: ETAE_0463Help
Entry
ETAE_0463         CDS       T01121                                 

Definition
(GenBank) putative phosphate/sulphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
etr  Edwardsiella tarda EIB202
Brite
KEGG Orthology (KO) [BR:etr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    ETAE_0463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ACY83310
UniProt: D0ZBD2
Position
complement(508826..510091)
Genome map
AA seq 421 aa AA seqDB search
MEIIANHGSLLIIVAAFFGLLMAIGIGANDVANAMGTSVGARAVTIRQAIVIAMIFEFAG
AYLAGGEVTQTIRSGIIDTSAFAGHPQTLVFGMMASLLAAGIWLIVASLMGWPVSTTHSI
IGAIIGFACVSVGPEAVEWGGVKGIVGSWIITPLISGVVAYGIFLSAQRLIFNTENPFAN
ARRFGPVYMFLTALVISLVTIKKGLKHVGLHLTDGETWLVSLLVSLLVMLGGYLYLSRKS
FTDDADEQDHFRGVERVFSLLMVITACAMAFAHGSNDVANAIGPLSAIVAIVRDPSVLAG
TSPIVWWILPLGGIGIVVGLALMGRRVMETVGTGITDLTPSRGFAAQFATASTVVIASGT
GLPISTTQTLVGAVLGVGFARGIAALNLNVVRNIVASWIVTLPAGAALSIALFYLLQAVF
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcattgccaatcacggctcattactgatcatagtggcggccttctttggcctg
ctgatggctatcggcatcggcgccaacgacgtcgccaacgcgatgggaacctccgtaggc
gcccgcgccgttaccatccgtcaggcgatcgtcatcgccatgatcttcgagttcgccggc
gcctacctggccggcggtgaagtcacccaaactatccgcagcggcatcatcgataccagt
gccttcgccggtcatccccagacgctggtcttcgggatgatggcctcgctgctggccgcc
ggcatctggctgatcgtcgcctcgctgatgggctggccggtctccaccacccactctatc
atcggtgccatcatcggctttgcctgcgtctcggtcggccctgaagcggtcgaatggggc
ggcgtgaagggtatcgtcggcagctggatcatcacaccgctgatctccggggtggtggcc
tatggcatcttcctcagcgcccagcggctgatctttaacaccgagaacccgttcgctaac
gcccgccgctttggcccggtgtatatgttcctgaccgcgctggttatctcactggtcacc
atcaagaaagggttaaagcacgtcggcctgcacctgacggacggcgagacctggctggtt
tcactgctggtgtccctgctggtcatgctcggcggctatctgtatctgtcgcgcaaatcc
tttaccgatgacgcagacgagcaggatcacttccgcggcgttgagcgggtattcagcctg
ctgatggtcatcaccgcctgtgccatggcctttgcccacggctctaacgacgtcgccaat
gccattggtccgctatctgccatcgtcgccatcgtacgcgatccgagcgtactggccggc
acctcccccatcgtctggtggatcctgccgctgggcggtatcggtatcgtcgtgggtctg
gcgctgatgggccgtcgcgtcatggaaaccgtgggaaccggtattaccgatctgaccccg
agccgtggctttgccgctcagttcgccaccgcctcaacggtggtgatcgcctccggcacc
ggcctgccgatctccaccacccagacgctagtcggcgccgtgctaggcgtcggctttgcc
cgcggcattgcggccctgaaccttaacgtggtacgtaacattgtcgcgtcatggattgtg
accctgcccgcgggagccgcgctctccattgccctattttatctgctgcaggcggtcttc
ggctaa

DBGET integrated database retrieval system