KEGG   Edwardsiella tarda EIB202: ETAE_0545Help
Entry
ETAE_0545         CDS       T01121                                 

Gene name
gpmB
Definition
(GenBank) phosphoglycerate mutase
  KO
K15634  probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
etr  Edwardsiella tarda EIB202
Pathway
etr00010  Glycolysis / Gluconeogenesis
etr00260  Glycine, serine and threonine metabolism
etr00680  Methane metabolism
etr01100  Metabolic pathways
etr01110  Biosynthesis of secondary metabolites
etr01120  Microbial metabolism in diverse environments
etr01130  Biosynthesis of antibiotics
etr01200  Carbon metabolism
etr01230  Biosynthesis of amino acids
Module
etr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
etr_M00002  Glycolysis, core module involving three-carbon compounds
etr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAE_0545 (gpmB)
  Energy metabolism
   00680 Methane metabolism
    ETAE_0545 (gpmB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAE_0545 (gpmB)
Enzymes [BR:etr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     ETAE_0545 (gpmB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACY83392
UniProt: D0ZBZ1
Position
592001..592648
Genome map
AA seq 215 aa AA seqDB search
MRQVYLIRHGETEWNVQRRIQGQSNSPLTVMGEQQARQVGARLGQMGITHVIASDLGRTQ
QTGEIIAAACRCPLTLDARLRELSMGVLESRLLASLSPQEEQWRLSMLDGSPQGCIPQGE
TMAQLAERMQQALNDCLALPQGSRPVLVSHGIALGCLLSTVLGLPPYAERRLRLRNCSLS
RVDYQQSAWLASGWVVETAGDVQHLAQPSMDEVLR
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgagacaggtatatcttattcgtcacggcgaaacggagtggaacgtacagcggcgtatt
cagggacagtcgaacagcccgctgaccgtgatgggcgaacagcaggcgcggcaggtcggc
gcgcgcttagggcagatgggcattacccacgtgatcgccagcgatctggggcgcactcag
cagacgggggagatcatcgccgcggcctgtcgctgtccgctgacgctggatgcccgtctg
cgcgagctgagcatgggggtgctggagtcgcgtctgttggcctcgctgtcgccgcaggag
gagcagtggcgcctgagcatgctggatggttcgccgcagggctgtattccgcagggggag
accatggcgcagctggctgagcgcatgcagcaggcgctgaacgattgcctggcgctaccg
caggggagccgtccggtgctggtgagccatggcattgccctgggctgcctgctctccacg
gtgctgggactgccgccgtacgctgagcgccgcctgcgcctgcgcaactgctcgctgtcg
cgggtggactatcagcagagcgcatggctggcgagcggatgggtggtcgaaacggcgggg
gatgtacagcatctggcccagccgtcgatggatgaagtgttacgttag

DBGET integrated database retrieval system