KEGG   Edwardsiella tarda EIB202: ETAE_0567Help
Entry
ETAE_0567         CDS       T01121                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
etr  Edwardsiella tarda EIB202
Pathway
etr00260  Glycine, serine and threonine metabolism
etr00750  Vitamin B6 metabolism
etr01100  Metabolic pathways
etr01110  Biosynthesis of secondary metabolites
etr01120  Microbial metabolism in diverse environments
etr01230  Biosynthesis of amino acids
Module
etr_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAE_0567 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ETAE_0567 (thrC)
Enzymes [BR:etr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ETAE_0567 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ACY83414
UniProt: D0ZC13
Position
620707..621993
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVNFAQALVQGLGRQQGLFFPHALPALARAQIDALLEQDFVTRSAHILA
AYLGDEFPFETLRDRVQAAFDFPAPVVPVSDDIAALELFHGPTLAFKDFGGRFMAQMLQQ
VAGERPVTILTATSGDTGAAVAHAFYGLKNVQVVILYPRGKVSPLQEKLFCTLGGNIRTL
AIEGDFDACQALVKQAFDDPTLCRELGLNSANSINISRLLAQICYYFEAVAQLPQAARNQ
LVISVPSGNFGDLTAGLLAQSLGLPVKRFIAATNANDTVPRFLSSGVWQPHETVATLSNA
MDVSRPNNWPRVEELFRRREWSLGALGSGALSDAQTAAAMRELAALGYVSEPHAAIAYRA
LRDDLQPGEYGLFLGTAHPAKFQESVEAILQRSIPLPQALAARAALPLLSQTLPADFSRL
RAALLDRP
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtacaatttaaaagatcacaacgagcaggttaactttgcgcaggcgctggtg
caggggctggggcgccagcagggactgttctttccccatgcgctgcccgccctggcgcgg
gcgcagatcgatgccctgctggagcaggattttgtaacccgcagcgcgcatattctggcg
gcgtatctgggggatgagttcccctttgagacgctgcgcgatcgggtgcaggccgccttc
gacttccctgcgccggtggtgccggtcagcgatgatatcgctgcgctggagctgtttcat
gggccgacgctggcattcaaggactttggcgggcgctttatggcgcagatgctgcagcag
gtcgcaggggagcggccggtgaccattctgaccgccacctccggcgataccggcgccgcg
gtcgcccatgcgttttatggtctgaaaaacgtccaggtggtgatcctctacccgcgcggc
aaggtcagtccgctgcaggagaagctgttctgtaccctgggcggcaatattcgtacgctg
gcgatcgagggcgatttcgatgcctgccaggcgctggtcaaacaggcgtttgacgatccg
acgctgtgccgtgagctggggctaaactcggctaactctatcaatatcagccggctgctg
gcgcagatctgctactactttgaggcggtagcccagctgccgcaggcggcgcgcaatcag
ctggtgatctcggtaccgagcggcaacttcggcgatctgaccgccgggctgctggcccag
tcgctggggctgccggtgaagcgttttatcgccgcgaccaatgccaatgataccgtgccg
cgtttcttatccagcggcgtctggcagccccatgagaccgtcgcgaccctctccaatgcc
atggacgtcagccgtcccaacaactggccgcgggtggaagagctgttccggcgtagagag
tggtcgctgggcgcgctgggctccggggcgctgagcgatgcgcagaccgcggcggcgatg
cgtgagctggcggcgctcgggtatgtcagcgaaccccatgctgctatcgcctatcgagcg
ctgcgtgacgatctgcagcccggcgagtatggcctgtttctgggaaccgcccatccggcc
aagttccaagagtctgttgaagcgatcctgcagcggagcatcccgctaccgcaggcgttg
gcggcgcgggctgcactgccgctgctgtcacagacgctgcccgccgacttttcccgcctg
cgggcggcactgctggatcgcccataa

DBGET integrated database retrieval system