KEGG   Edwardsiella tarda EIB202: ETAE_0587
Entry
ETAE_0587         CDS       T01121                                 

Gene name
xdhC
Definition
(GenBank) xanthine dehydrogenase, Fe-S binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
etr  Edwardsiella tarda EIB202
Pathway
etr00230  Purine metabolism
etr01100  Metabolic pathways
etr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:etr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETAE_0587 (xdhC)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: ACY83434
UniProt: D0ZC33
Position
complement(644189..644674)
AA seq 161 aa
MNVKEWGEISCQINGKNYQFCVSPAMSLLEMLREHGLTSVKQGCCVGECGACSVLIDGVA
TDSCLYLALWADGKQIVTAEGLGRTDSLSPIQQAYVDAGAVQCGFCTPGLVVATHALLAK
PRSRPLTHEEIRRGLSGNLCRCTGYQAIVRAVDLCQREEEQ
NT seq 486 nt   +upstreamnt  +downstreamnt
atgaatgtcaaagagtggggtgaaatcagctgccagatcaatgggaaaaactatcagttt
tgcgtatcgccggcgatgtcactgctggaaatgctgcgcgagcacgggctaaccagcgtg
aagcagggctgctgcgtcggcgaatgcggcgcctgcagcgtattgatcgatggcgtggca
accgacagctgcctgtatctggcgctgtgggccgacggtaagcagatcgtcacggccgaa
gggctggggcgaaccgacagcctttcaccgatccagcaggcctatgtcgacgccggtgcc
gtgcagtgcggcttctgtaccccgggactggtggtcgcgacccatgccctgctggcgaaa
ccgcgcagccgcccgctgacgcacgaagagatccgccgcggcctctccggtaacctgtgc
cgctgcaccggctatcaggccatcgtacgcgccgtcgatctctgccagcgcgaagaagag
cagtaa

DBGET integrated database retrieval system