KEGG   Edwardsiella tarda EIB202: ETAE_0589
Entry
ETAE_0589         CDS       T01121                                 

Gene name
xdhA
Definition
(GenBank) xanthine dehydrogenase subunit XdhA
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
etr  Edwardsiella tarda EIB202
Pathway
etr00230  Purine metabolism
etr01100  Metabolic pathways
etr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:etr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETAE_0589 (xdhA)
Enzymes [BR:etr01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     ETAE_0589 (xdhA)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: ACY83436
UniProt: D0ZC35
Position
complement(645556..647847)
AA seq 763 aa
MSLGSPLRRVDAEAKVTGQARYTDDMMMPGMLHACYVRSRIAHGNVTAIDTREAESMPGV
EAVFTFHDVPSAPFPTAGHAWSLEPGKRDIADRHLLTGHVRHFGDGVAIVVARDLLSAER
AAERVQVSYEALPVITRPLAALADNAPAIHPGGNLLRHSEIDAGEPDARMAAADLQLEGH
YETPVVQHCHMEGVTCYAYMEQPDHIVIVSSTQIPQIVRRTVAQALGLPWSHVRVIKPYV
GGGFGNKQDVLEEPMAAFLTQRLGGKPVKVSLSREECFVATRTRHAFSIDARLGMRRDGQ
LEGYRLTVLSNTGAYASHGHSIAAAGANKISYLYPRSAFGYCADTVYTNLPAAGAMRGYG
APQVDFALECLMDDAAARLDLDPLEVRLRNVARQGDRNPVNGKTIYSAGLTECLEKGRRL
FEWDQRRAECLAQPADAPVRRGVGVACFSYGSNTYPVGVEIAGARLLLNQDGTVNLQIGA
TEIGQGSDTVFAQMASETLGIPFKQIRVISTQDTDITAFDPGAFASRQSYVAAPAIRRAA
EIMRQKILAHAALISHQPEWGLTLCDGNVVMAMQPDQVLMSVADVAMQAYYHQEIGAQIL
AEVSHKTTTNPPAFGCTFVDLSIDIALCQVTINRILNLHDSGRILNPQLAEGQVHGGMGM
GIGWALFEEMIIDEKSGVVRNPNLLDYKFPTCVDLPDLECAFVETVEPQSAYGHKALGEP
PIISPGPAIRNAIRMATGVAINALPITPKTLYREFVQAGLIRE
NT seq 2292 nt   +upstreamnt  +downstreamnt
atgtctttaggatcgccgctgcggcgggttgatgccgaagccaaggtcaccggacaggca
cgttataccgatgatatgatgatgcccggcatgctccatgcctgctacgtgcgcagccgt
atcgcccacggtaacgtcaccgccatcgatacccgggaagcggagtccatgcccggcgta
gaagccgtcttcacctttcacgatgtcccctcagcccccttccctaccgccggccatgcc
tggtcactggagccgggcaaacgggatatcgccgatcgccatctgctgaccggccacgta
cgccactttggcgatggcgtcgccatcgtcgtcgcccgcgatctgctcagcgccgagcgc
gccgcggagcgggtacaggtcagctatgaggcgttgccggtgatcacccgaccactggcg
gccctggccgataatgcgccggccattcaccccggcggcaatttactgcgtcacagcgag
atcgacgccggagagcccgatgctcgcatggccgccgccgatctgcagctggagggacac
tacgagacgccggtggtgcagcactgccacatggagggcgtgacctgctatgcctatatg
gagcagcccgatcacatcgtcattgtctccagcacccaaattccccagattgtccgccgc
accgtcgcccaggccctcggtctcccctggtcgcacgtccgagtgatcaagccctacgtc
ggcggcggattcggcaataagcaggatgtgctagaagagcccatggccgcctttttaacc
cagcgcctcggcggtaaaccggtcaaggtcagcctgagccgcgaggagtgcttcgtcgcc
acccgcactcgccatgccttcagcatcgatgcccggctgggcatgcgtcgggatggacaa
ctggagggctaccggcttacggtgctgtccaacaccggcgcctatgcctctcacggccac
tcgatcgccgccgccggcgccaataaaatcagctatctctatccccgcagcgcctttggc
tactgcgccgatacggtatataccaacctgcccgccgccggtgcgatgcgcggctacggc
gcgccgcaggtcgactttgccctggaatgcctgatggacgacgccgccgcccgtctcgat
ctcgaccccctcgaggttcgtctgcgcaacgtcgcgcgtcagggggaccgcaacccggtt
aacggcaagaccatctacagcgccgggctcaccgagtgcctggaaaaaggccgccgcctg
tttgagtgggatcagcgccgcgccgaatgtctggcccagccggccgatgcgccggtgcgg
cgcggcgtcggcgtcgcctgtttcagctatggctccaatacctatccggttggggtggag
atcgccggcgcccgcctgctgctcaatcaggacgggacggtaaacctgcagattggcgcc
accgaaatcggccagggatccgacaccgtctttgcccagatggcatcggagacgctgggg
atcccctttaaacagatccgggtgatctcaactcaggataccgatatcaccgccttcgat
cccggcgcctttgcctcacggcaaagctacgtcgccgccccggcgatccgccgagcggcg
gagatcatgcgccagaagatcctggcgcacgcggcgctgataagccaccagccggagtgg
ggattgaccctgtgcgacggtaacgtcgtgatggcgatgcagccggatcaggtgctgatg
agcgtcgccgatgtcgccatgcaggcttactaccatcaggagatcggcgcgcagatcctg
gccgaggtctcccataaaaccaccaccaatcccccggccttcggctgcacctttgtcgat
ctcagcatcgatatcgcgctgtgccaagtcaccattaaccgcatcctgaatctgcatgac
tccgggcggatcctcaacccgcagctggcggaggggcaggtgcacggcggcatgggaatg
gggatcggctgggcgctgttcgaagagatgatcatcgatgagaagagcggcgtggtacgc
aacccgaatctgctcgactacaaattccccacctgtgtcgatctgccggatctggagtgc
gcctttgtcgagaccgtggagccgcagtcggcctatggccacaaggcgctgggtgagccg
ccgatcatttcgcctggaccggcgatccgcaacgccattcgcatggcaacgggggtcgcg
atcaatgcgctgccgatcacccccaaaacgctgtatcgcgaatttgtgcaggccggactg
atcagggagtaa

DBGET integrated database retrieval system