KEGG   Edwardsiella tarda EIB202: ETAE_1266
Entry
ETAE_1266         CDS       T01121                                 

Definition
(GenBank) hypothetical protein
  KO
K09911  uncharacterized protein
Organism
etr  Edwardsiella tarda EIB202
Brite
KEGG Orthology (KO) [BR:etr00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    ETAE_1266
SSDB
Motif
Pfam: MatP MatP_C RHH_4
Other DBs
NCBI-ProteinID: ACY84109
UniProt: D0ZFS7
Position
1378436..1378894
AA seq 152 aa
MKYQQLENLECGWKWKYLVKKHREGEPITRYQELSQAQQAVELLLRLEHEPVKVLPWIRE
HMDPALGNRMKQTIRARRKRHFNAENQHTRKKSIDLEFLVWQRLAALAQRRGATLSDTIV
QLIEDAERKELYASQMSSLKQDLQAFLHSERD
NT seq 459 nt   +upstreamnt  +downstreamnt
atgaaatatcaacagcttgaaaatctggagtgtggctggaagtggaaatacctggtgaaa
aaacaccgggaaggggagccgatcacccgctatcaggagctcagtcaggcccagcaggcg
gtggagctgctgctgcgtctggagcatgagccggtaaaggtgctgccctggatccgcgaa
catatggatccggcgctgggtaaccgcatgaagcagactattcgcgcccgacgtaaacgc
cattttaacgctgaaaatcagcatacccgtaagaagtccatcgatcttgagtttttggtc
tggcagcgtttggctgcgctagcgcagcggcggggcgcgaccctgtccgataccatcgtt
cagcttatcgaggatgcggagcgtaaagagctgtatgccagtcagatgagttcgctaaag
caggatctgcaggcatttttacacagtgaacgggattaa

DBGET integrated database retrieval system