KEGG   Edwardsiella tarda EIB202: ETAE_1555Help
Entry
ETAE_1555         CDS       T01121                                 

Gene name
rrmA
Definition
(GenBank) 23S rRNA methyltransferase A
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
etr  Edwardsiella tarda EIB202
Brite
KEGG Orthology (KO) [BR:etr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:etr03009]
    ETAE_1555 (rrmA)
Enzymes [BR:etr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     ETAE_1555 (rrmA)
Ribosome biogenesis [BR:etr03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ETAE_1555 (rrmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_23 MTS Methyltransf_12 Pox_MCEL PrmA Methyltransf_32 TPMT Methyltransf_9 CMAS PCMT MetW Ubie_methyltran
Motif
Other DBs
NCBI-ProteinID: ACY84396
UniProt: D0Z7H7
Position
1662485..1663288
Genome map
AA seq 267 aa AA seqDB search
MPYQCPLCHSPLRQDAHQWCCVNNHRFDCAKEGYVNLMPVQFKHSRQPGDSSEMMQARRA
FLQADHYLPLRDAVQGLLARYLPADGGNVLDIGCGEGYYTASWASVRGAQVYGLDIAKVA
IRYAARRYPQVHFCVASSLRLPFADASIGGAVRIYAPCNAQELARVVATGGCLVTVTPAE
RHLYQLKALVYPEVHLHAQKAESLPGFTLVESQRLGYAMTLNGDEAAALLQMTPFAWRAP
QGVAEALLARATFECETDFLIRVYRRD
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgccgtaccaatgtcccctgtgccactcaccgctgcgccaagatgcgcaccagtggtgc
tgcgttaacaaccatcgctttgactgcgcgaaagaggggtatgtcaacctgatgccggtg
cagtttaaacactcgcgtcagccaggcgacagcagtgagatgatgcaggcccgtcgggcc
tttttgcaggcggaccattacctgccgctgcgcgacgccgtacaaggccttctggcgcgc
tatttacccgctgacggcggtaacgttttggacatcggctgtggcgagggatattacacc
gccagctgggccagcgtgcggggggcgcaggtgtatgggctggacatcgccaaggtggcc
attcgctatgcggcgcggcgctatccgcaggttcacttctgcgtggcgtccagtctgcgc
ctgccgttcgccgatgccagcatcggcggtgcggtacgtatctacgcgccgtgcaatgcg
caggagctggcgcgagtggtggcgacggggggctgtctggtgaccgtgacgccggcggag
cgtcatttgtatcagctgaaagcgttggtctaccccgaggtgcatctgcatgcccagaag
gcggagtcgctgccgggctttaccctggtcgagagccagcgtctgggctatgccatgacg
ctgaacggggacgaggcggcagcgctgctgcagatgacgccctttgcctggcgggcgccg
cagggggttgcagaggcgctgctggcgcgcgcgacgtttgagtgtgagactgacttcttg
atccgggtctatcgccgcgactga

DBGET integrated database retrieval system