KEGG   Edwardsiella tarda EIB202: ETAE_1641Help
Entry
ETAE_1641         CDS       T01121                                 

Definition
(GenBank) putative Gifsy-1 prophage protein
Organism
etr  Edwardsiella tarda EIB202
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACY84482
UniProt: D0Z7R3
Position
complement(1743532..1744014)
Genome map
AA seq 160 aa AA seqDB search
MGCSAFAPTYALSAADVSGITHHAVQFPKGGSNATIKSRIKGENVLDYTLIAANGQHISI
TLNGASSTYFNLMAPGSTGEALFNGAMDGDSYQGILPTKGQYTVRVYPMGAAKQSNTAHP
LYPEDRDRGCRDSASSKGDRGQRQTTLRTAAQSADGTVPF
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
ttgggttgcagcgccttcgcgccgacgtatgccctatccgcagcggatgtcagtggcatc
acccatcatgcggtacaatttcccaaaggcggatccaacgcgacgataaaaagccgcatt
aaaggcgaaaatgtcctggattacacgctaattgccgcgaacggacagcatattagcatc
acgcttaacggcgcttcgtcgacctacttcaacctgatggcgcccggtagcacaggtgag
gcgctctttaacggcgcgatggatggcgatagctaccaaggcattctaccgacgaaagga
caatacactgtacgggtctacccgatgggcgctgccaagcaatccaacacagcgcacccc
ctttaccctgaagatcgcgatcgcgggtgccgcgacagcgcaagcagcaaaggcgaccgc
ggccagcggcaaactaccctgcgcacagcagcgcagtcagccgatgggacagtgcccttt
tag

DBGET integrated database retrieval system