KEGG   Edwardsiella tarda EIB202: ETAE_1643Help
Entry
ETAE_1643         CDS       T01121                                 

Definition
(GenBank) DNA-binding protein
Organism
etr  Edwardsiella tarda EIB202
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF134 HTH_23 Sigma70_r4_2 HTH_29 HTH_3 Sigma70_r4 HTH_28 MarR_2 HTH_10 HTH_30 HTH_31 KORA HTH_psq HTH_8 HTH_Crp_2 HTH_38 HTH_17 MarR Phage_CI_repr
Motif
Other DBs
NCBI-ProteinID: ACY84484
UniProt: D0Z7R5
Position
complement(1744679..1744888)
Genome map
AA seq 69 aa AA seqDB search
MPLQQLEQVTLARDEFEALRLVDREGLQQQQAAAEMGVSRQTLANILKRARFKLLDCLSN
GKALMIDEL
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgcagcagttggaacaggtcacgctggcgcgcgatgagtttgaagccctgcgg
ctggtcgatcgcgaggggttacagcagcagcaggccgccgcagagatgggcgtctctcgc
cagacgctggccaatattctcaagcgggcgcgctttaagctgctggactgtctcagtaat
ggcaaggcactgatgattgatgagctgtaa

DBGET integrated database retrieval system