KEGG   Edwardsiella tarda EIB202: ETAE_1649Help
Entry
ETAE_1649         CDS       T01121                                 

Definition
(GenBank) putative tetrathionate reductase, subunit A
  KO
K08357  tetrathionate reductase subunit A
Organism
etr  Edwardsiella tarda EIB202
Pathway
etr00920  Sulfur metabolism
etr01120  Microbial metabolism in diverse environments
etr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etr00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    ETAE_1649
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAE_1649
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etr02000]
    ETAE_1649
Transporters [BR:etr02000]
 Other Transporters
  Transmembrane electron carriers [TC:5]
   ETAE_1649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Molybdopterin Molydop_binding Molybdop_Fe4S4 TAT_signal
Motif
Other DBs
NCBI-ProteinID: ACY84490
UniProt: D0Z7S1
Position
1749409..1752495
Genome map
AA seq 1028 aa AA seqDB search
MDKRRRHLLKLGLAAGGGAVFAAGYATTVRRAAREVTQGSAGEPTRSAQFGNALQPELRI
DGGGRLAVNPQQRLANGMCFGCWTLCGVRLRIDNNSERILRIGGNPYHPLSQQQQIPYAT
PLAQAWRSLAGEAGLMGRSTACARGNGMLEIRESPYRITQPMKRVGKRGEGRWQTISYEQ
LLQEICDGGDLFGEGPVEGLRSLRDLTTPLDAAHPEFGPRANQLLVTNASDEGRDHIIKR
FALNSFGTRNFGHHGSYCGYSFRAGSGALMHDLDKNAHMKPDLEAVEFVLYIGTSPAQSG
NPFKRQARQLAAARTQTGFSYVVVAPSQPVSTSLAAGDNNRWLPIRPGTDAALALAMIRW
ILAQQRYNAAYLSQPGEAAMMQAGQAHWCNATHLVICQPGHPREGQFLRRSDLPGGVSET
QDPPALVLAAADGALVSAEIAAPAQLWVDTELSGAQGPLRVKSALSCLRDEAQKLTLAQY
SDICGVPEADIVALAREFTAHGTRAAVDTHGGTMHANGFYTAYAILMLNVLIGNINLKGG
MMAKPPAYPAFGRGPCYDFERFPGKVKPGGLMLSRSKAHYEQSSEYREKVAAGVSPYPSR
APWYPLSAPLLTEQLCAALDGYPYRLKAWISHIANPLYGVPGLRALLEDRLRSPAQLPLI
VAVDAFINETSALADYLVPDTVTYESWGIAGIWQGVPTRAATVRWPAVTPLSARTADGRP
ISLENFLIDLAKRLALPGFGARAQQNAQGEWLAIDSGEQYYLRATANLAQLDTPVAPATA
QDVALSGVDRLLPLLQATLPAAEVGPVASVLARGGRFEDAALRYQGEMMAHRYRRPFAVW
NAQVAAARNSMTGERYCGCPTWMAPRLADGTPLRERWPQEAWPFELTSYKSNIHSAVSAL
SPRLCAVKRDNPIYLHPTDAERLGIGNGDAVEVTTPGGALRAQAMILDSVMPGVIAVEHG
YGHWELGARSHIIDGRAQPAPPVTLAGVSLNQLGLVDPTRQSPGLLLDWVVGSAARQGLP
ARIRRLAS
NT seq 3087 nt NT seq  +upstreamnt  +downstreamnt
atggataaacgcagacgtcatttactgaagctggggctggccgcgggcggcggcgccgtg
ttcgccgccggctatgccacgacggtgcgccgtgcggcgcgcgaggtgacgcagggcagc
gccggtgagccgacgcgtagcgcccagtttggcaacgcgctgcagccggagctgcgtatc
gacggcggagggcggctggcggtcaacccgcagcagcgcctggccaatgggatgtgcttt
ggctgctggaccctgtgtggggtgcgcctgcgtatcgataataacagcgaacggatcctg
cgcatcggcgggaatccctaccatccgctctctcagcagcagcagatcccctacgccacg
ccgctggcgcaggcctggcgctctctggcgggcgaggcggggctgatggggcgttcgacc
gcctgcgcccgcggcaatgggatgctggagatccgtgaaagcccgtaccgtatcacccag
ccgatgaagcgggtggggaaacgcggcgaggggcgctggcaaaccatcagctatgagcag
ctgctgcaggagatctgcgacggcggcgatctgttcggcgaggggccggtggaggggctg
cgttcgctgcgagacctgaccacgccgctggatgcggcgcacccggagtttgggccgcgg
gccaaccagctgctggtgaccaacgccagcgatgaagggcgcgatcacatcattaaacgc
tttgccttgaacagcttcggcacccgcaactttggccatcacggttcgtactgcggctat
tcgtttcgcgccggctccggcgcattgatgcacgatttggataagaacgcgcacatgaag
ccggatctggaggcggtggagtttgtgctgtatatcggcacctcaccggcgcagtcggga
aacccctttaagcgccaggcgcgccagctggccgccgcgcgaacccagacgggatttagc
tacgtggtggtagcgccgtcgcagccggtgagcaccagcctggcggccggggataataac
cgctggctgccgatccgccccggcaccgatgcggcgctggcgctggcgatgatccgctgg
atcctggcgcagcagcgttacaacgccgcttacctcagccagccgggcgaggcggccatg
atgcaggccggccaggcccactggtgtaatgcgacgcatctagtgatttgtcagcccggg
cacccgcgcgaggggcagtttttgcgccgttcggatctgccggggggcgtttcggagacg
caggaccctccggcgctggtgctggctgcggcggacggcgcgctggtcagcgctgagatc
gcggcgccggcccagctgtgggtggataccgagcttagcggcgctcagggtcctctgcgg
gtaaaaagcgcgttgagctgcctgcgcgacgaggcgcaaaagctgacgctggcgcagtac
agcgacatctgtggggtgcccgaggcggatatcgttgcgctggcgcgggagtttaccgcc
cacgggacgcgcgcggcggtggatacccacggcggaaccatgcatgccaacggcttctat
accgcctatgccatcctgatgctgaatgtgctgatcgggaatattaatctgaaggggggg
atgatggccaagccgccggcctatcccgcctttggtcgcgggccgtgctatgacttcgag
cgctttccgggcaaggtcaagcccggcggtctgatgctgtcgcgcagcaaggcgcactat
gagcagagcagcgagtaccgtgagaaggtcgccgcgggcgtctcgccctatccctcgcgg
gcgccgtggtatccgctgtcggcgcccctgctgaccgagcagctgtgcgccgcgctggac
ggctatccctaccgcctgaaggcgtggatcagccacatcgcaaacccgctgtacggggtg
ccggggctgcgcgccctgctggaggatcgcctacgctccccggcgcagctgccgctgatc
gtggcggtcgatgcctttatcaacgagacctcggcgctggccgactatctggtgccggat
acggtcacctatgagagctgggggatcgccgggatctggcaaggggtgccgacgcgggcg
gcgacggtgcgctggccggcggtgacgccgctgagcgcgcggacggcggacggtcgtccg
atcagcctggagaatttcctgatcgacctggccaagcggctggcgctgcccggctttggc
gcccgggcgcagcagaatgcgcagggggagtggctggcgatcgacagcggagagcagtac
tacctgcgcgccacggccaacctggcgcagctggatacgccggtggcgccggcgacggcg
caggacgtggcgctgagcggggtcgatcgcctgctgccgctgctgcaggcgacgctgccg
gcggctgaggtggggccggtggccagcgtactggcgcgcggcggtcgttttgaggacgcg
gcgttgcgctatcagggagagatgatggcccaccgctaccgtcgcccgtttgccgtgtgg
aatgcgcaggtggcggcggcgcgcaacagcatgaccggcgagcgctactgcggctgtcca
acctggatggcgccgcgtctggcggacggtacgccgctgcgcgagcgctggccgcaggag
gcgtggccctttgagctgaccagctacaagtccaatattcacagcgccgtgtctgcgctg
tcgccgcgcctgtgcgccgtgaagcgcgataatccgatctacctgcacccaacggacgcc
gagcggctggggatcggcaacggcgatgccgtcgaggtgacgacgccgggcggcgccctg
cgggcgcaggcgatgatcttggacagcgtgatgcccggggtgatcgccgttgagcacggc
tatggccactgggagctgggcgcccggtcgcatatcatcgacggacgggcgcagcccgcg
ccgccggtgacgctggcgggcgtcagcctgaaccagctggggctggttgacccgacccgt
cagagcccggggctgctgctggactgggtggtcggctcggccgcccgccaggggctgccc
gcccgcattcggcggctggcgagctaa

DBGET integrated database retrieval system